SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000430 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000430
Domain Number 1 Region: 955-960,1020-1396
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 1.11e-91
Family Formin homology 2 domain (FH2 domain) 0.0000877
Further Details:      
 
Domain Number 2 Region: 15-239
Classification Level Classification E-value
Superfamily ARM repeat 5.38e-31
Family Diap1 N-terninal region-like 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000430   Gene: ENSMODG00000000359   Transcript: ENSMODT00000000440
Sequence length 1545
Comment pep:known_by_projection chromosome:BROADO5:3:86360860:86707070:-1 gene:ENSMODG00000000359 transcript:ENSMODT00000000440 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLYIILFISERLYNSSGRELRRALFSLKQIFQDDKDLVHEFVVAEGLTCLIKVGAEADQN
YQNYILRALGQIMLYVDGMNGVINHNETIQWLYTLIGSKFRLVVKTALKLLLVFVEYTES
NAPLLIQAVSSVDAERGVKPWSNIMEILEEKDGVDTELLVYAMTLVNKTLSGLPDQDAFY
DVVDCLEELGIEAISQRHLNKKGTDLDLVEQFNIYEMTLRHEDGDENAEPPPNGRKDRRR
ASLGSSEHRGLNRRRSRRHSVQSVKSTLSAPTSPCNQPAPSFKLSQSHPVGDLSEKEEEE
EEEEFEEEEQPITEPNSEDEREEDASCQVKESEGNSPSEINQVENDNISESSEISTSTST
MSQGKWISPNDKSKSPSCNSLFVPGSSPGSSLCHASHLPSSSVSVFTTSSSASTHQKASP
VVEKLPYIPHTPFHLFSYDFEDSPLTAKEKEREVQKENSASDPVHLNKYSDSDSDPYNFR
SFSSNRYSNYGSSSYFSTRGYSGSSAPTTPTSSLSSYQESKSERSPLSGLLTSSFRQHQE
SLAAERERRRQEREERLQRIEREERNKFNRDYLDKREEQRQAREERYKYLEQLATEEYEK
ELRSRSTSRGRTELCLDLSAPAAPTSPLPKCISPSSIQSREELKETSVSQGTTQPAEATF
IVEETKANKVRASDPEPEAETETERVEAEEGHKAEAGAEQRVDVPPSQEVLCRRGRPKSE
GTQGPEESAILSEKERQNEEVNEKDNCSASSISSTSSTLEREEKESKLTSDNEAGLWSQT
IQDAGVNEQCSNILNNKRFMLDMLYAHNKKPKDEEEKELEKVEERKRTEEGEEPITCVAS
RISVLQANSQAKDENVRKMEIENLDNQGSVKAFAEKFNSGELTKGTASSEMGIGEQVSEK
TQAQPKKESDYIWDQLMANPRELKIKEMDFTDLGDEDDIDVLDMDWGPRDSLIPPPPPPP
SFLCLPPPPPPPLFDCSSPTPAPANLLAPPPMFGTPQGLGWPQVPRGQPAFTKKKKTIRL
FWNEVRPFEWQCKNKRCREFLWSKLEPIKVDTSKLEHLFESKSKELSVTKKTAADGKRQE
IIVLDSKRSNAINIGLTVLPPPRTIKIAILNFDEYALNKEGIEKILTMIPTEEEKQKIQE
AQMANPDLPLGSAEQFLLTLSSISELSARLQLWAFKMDYEVIEKEVAEPLLDLKEGIDQL
ENNKTLGFILSTLLAIGNFLNGSNAKAFELSYLEKVPEVKDTVHKQSLLHHVCTMVVENF
PDSTDLYSEIGAITRSAKVDFDQLQDNLCQMERRCKASWDHLKAIAKHEMKPVLKQRMSE
FLKDCAERIIILKIVHRRIINRFHSFLLFMGHPPYAIRDVNITKFCRIISEFALEYRTTR
ERALQQKQKRANHRERNKTRGKMITDTGKFSSNSTPSQSQPQGLDYAEDAAEHEHMKAVL
KTSSLGEEGTSVLGVRTRSRASRGSTSSTWHAGIDDSPNVTDDAADEIMDRIVKSATQVP
SQRVVPRERKRSRANRKSLRRTLKSGLTPEEAKALGLVSTSEMQL
Download sequence
Identical sequences F6R9K2
ENSMODP00000000430 ENSMODP00000000430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]