SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000588 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000588
Domain Number 1 Region: 107-165
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.1e-23
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 2 Region: 165-221
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.24e-21
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 3 Region: 1-46
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.85e-19
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 4 Region: 224-281
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.33e-19
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 49-103
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.14e-19
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 6 Region: 270-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.19e-16
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000588   Gene: ENSMODG00000015697   Transcript: ENSMODT00000000603
Sequence length 336
Comment pep:novel chromosome:BROADO5:Un:56132324:56146967:1 gene:ENSMODG00000015697 transcript:ENSMODT00000000603 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RIHTGEKPYKCSDCGTSFIDSSSLAQHQRIHTAEKPYKCSECGAAFTHTFGDSSSFTKHQ
SIHTGEKPNKCNDCRKSFSDSSSFTRHQRIHTGEKLYKCTLIECGYTYRQNALLVLHLRV
HTGEKPYECSRCGKAFSSSSSLMKHQRIFDTGEKPYECNECGKGFNDGSSRTKHQRIHTG
DKPYTCSDSGTSFIDCSSLAQHQRIHTGEKPYKCSECGAAFTHTFRQNAFLILHQRMHTG
EKPYEWSGRGKAFGDSSSFTKHQSIHTGEKPNKCNDCRKSFSDSSSFTRHQRIHTGEKPY
KCTCGKSFSDSSSLSHHQRIHPGGKNPLSLMNVVTP
Download sequence
Identical sequences H9H5W8
ENSMODP00000000588

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]