SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000593 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000593
Domain Number 1 Region: 186-242
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.86e-21
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000593
Domain Number - Region: 165-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0506
Family Classic zinc finger, C2H2 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000593   Gene: ENSMODG00000000499   Transcript: ENSMODT00000000608
Sequence length 360
Comment pep:known_by_projection chromosome:BROADO5:6:19275842:19302405:-1 gene:ENSMODG00000000499 transcript:ENSMODT00000000608 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MIRGIEAAMAENQSPLFQQQPPPPPVIFCHDSPKRVLVSVIKTTPIKPKRSSEQEPPPPL
IPTSPGFSDFMVYPWRWGENAHNVTLSPGGPGGGSCCGASVVAASPASSSVSAQQALRGR
GGPASTVVATAISGGEEEEEAGSPDSSHLRDGIRRGRPRADTVRDLINEGEHSSSRIRCN
ICNRVFPREKSLQAHKRTHTGERPYLCDYPDCGKAFVQSGQLKTHQRLHTGEKPFVCSEN
GCLSRFTHANRHCPKHPYARLKREEPTDGLNKNQTADNKAVAEWLAKYWETREQRTPTLK
GKPIQKADQEQQDPLEYIQSDEEDDDKNGARRLLQEQRERLHGALALIELANLTGAPLRQ
Download sequence
Identical sequences F6TU95
ENSMODP00000000593 XP_001368748.1.35504 ENSMODP00000000593

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]