SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000759 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000759
Domain Number 1 Region: 99-155
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-22
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 769-840
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000000021
Family Homeodomain 0.00063
Further Details:      
 
Domain Number 3 Region: 502-558
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000381
Family Homeodomain 0.0059
Further Details:      
 
Domain Number 4 Region: 618-676
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000295
Family Homeodomain 0.00088
Further Details:      
 
Domain Number 5 Region: 320-375
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000000642
Family Homeodomain 0.01
Further Details:      
 
Domain Number 6 Region: 848-893
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000513
Family Homeodomain 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000000759
Domain Number - Region: 72-97
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000106
Family Classic zinc finger, C2H2 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000759   Gene: ENSMODG00000000636   Transcript: ENSMODT00000000776
Sequence length 962
Comment pep:known_by_projection chromosome:BROADO5:1:393625269:393635683:1 gene:ENSMODG00000000636 transcript:ENSMODT00000000776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTTPCMIPVKTVVLQETEADPVEGFNEGTQQELPPETPSVNDAVNNNNNNNGTL
SNGHRNTFDGDSYVCKYCDFGSQDMNQFMGHMNSEHTDFNKDPTFVCIECSFMAKTSEGL
SLHNAKCHTGEISFIWNVAKQDNHITVEQIISDSTSSHDLSGESYEEGIDGQAEIIITKT
PIMKIMKVKAEAKKIHTLKENLPNSSVGENLLSQPAGDNLVSQSVGETDVKESDHSFTNG
SVPVSQATSNPVKTSHVANGPLIGTVPVLPAGIAQFLSIQQQPQVHAQHHHHQPLPTSKS
LPKVMIPLSSIPTYNAAMDSNSFLKNSFHKFPYPTKAELCYLTVVTKYPEEQLKIWFTAQ
RLKQGISWSPEEIEDARKKMFNTVIQSVPQPTITVLNTPLVANAGNVQHLIQAALPGHVV
TGQPEGTGGLLVTQPIMANGLQGTSSSLTLAVTSVPKQPAVAPHNTVCSNTASTVKVVNA
AQSLLTACPTITSQAFLDSSIYKNKKSHEQLSALKGSFCRNQFPGQGEVEHLTKITGLTT
REVRKWFSDRRYHCRNLKGTRSMLPGDNSSMIMDSAPDVTFTLSPKAPDLACVTTATTPG
VHHSAKRQSWHQTPDFTPTKYKERAPEQIRALESSFAQNPIPLEEEVDRLRSETKMTRRE
IDSWFSERRKKKSAEENKKSEEAASQEEEEVEEDCGEEDPADEWRVSSENGSSEAPGGDQ
PRVERKVSPIKINLKNLRVTEANGRNESLGLSANDHEEEQGLNKSLEQPKNKVNYKKTAQ
QRHLLRQLFVQTQWPTNQEYDGLVSQSGLPRAEVVRWFGDSRYALKNGQLKWYEDYKHGN
FPPGLLVISPSNRELLQDYYKTHKTLYEDDLQSLCDKTQMSSQQVKLWFAEKMGEETRAV
SDTCSEDQYSSTGEQAGNPKGTGDTYSEVSENSESWEPSGQEISSEPFDTLSPQAGIQLE
AD
Download sequence
Identical sequences F6TAB2
ENSMODP00000000759 XP_007474394.1.35504 XP_007474395.1.35504 XP_007474396.1.35504 XP_007474397.1.35504 XP_007474398.1.35504 XP_016288642.1.35504 XP_016288645.1.35504 XP_016288649.1.35504 ENSMODP00000000759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]