SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000807 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000807
Domain Number 1 Region: 301-363
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000574
Family HkH motif-containing C2H2 finger 0.056
Further Details:      
 
Domain Number 2 Region: 524-575
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000698
Family Classic zinc finger, C2H2 0.093
Further Details:      
 
Domain Number 3 Region: 372-407
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000211
Family HkH motif-containing C2H2 finger 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000807   Gene: ENSMODG00000000675   Transcript: ENSMODT00000000825
Sequence length 1027
Comment pep:known_by_projection chromosome:BROADO5:3:440084388:440203145:-1 gene:ENSMODG00000000675 transcript:ENSMODT00000000825 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRGRGREGHVLSAPFSLPLSPPGPAGFCEDAKMAASNYYGFAPGGGPQYSTQPATAYSHS
STATNYSVQPSPGVPQAVTPSYAPTTQTPRQISSVGFGGYQAHSGQDYNYSTRQQEPASQ
STTTPNYQDSYSYGRSTPASNYENKPYYQPTATQAQHTATDSYFQSGTKGGYSQPTSGYS
QNQPQRQVTTIKPVQTVSTTSSSYNAYPAVTSVQPNVPASSIPSYTSSSSYNSTSASYTG
SNYSTYDASVYSAADSYYPAPQQLQPPLQPPPQPQPITPQQQHPQPLPQPLQLPPLPKPT
GPSLFPKKPPFQNKQLKPKGPLKQPQLYYCDICKISCAGPQTYREHLEGQKHKKKEAAQK
LGNQSNIGLRGVQTQLHCELCDVSCTGADAYAAHIRGSKHQKVIKLHTKLGKPIPSVEPV
LLNSVPTNIVNKLVPQVTTTATTSVTPAKAANVAINNSTSYPRRPVLTKKPLTSKITYVG
TNKPQAAGNRLEEGTMVQSKSELPSKQSTHENSGDASGVLFDVQPVGHDYVEEVHNDEGK
MIRFHCKLCECSFNDPNAKDMHLKGRRHRLQYKKKVNPDLPVEIKPSNRARKHHEEKIKK
QKQKDMLKRWREEQQRHHIEMRRYEEEIYWRRVEKEQLYWEKHQHRMVTDWNPPPLMGRP
GGPVPSLLGSRRPNTSDDRHIMSKHSTIYPTEAELQAIQKVVSHSERALKLVSDILAEEK
SEHQEEEGGEKGKIDSSSRILKGVMRVGILAKGLLLKGDRNVQLILLSAEKPTQSLLQKI
TEQLPKQLLTVTEDKYEVSSDTEEANIVIASCKEPKMQVTVSVTSPLMREETSTDKEESQ
TDPVDVLSQQKCLESLAALRHAKWFQARANGLQSCVIVIRVLRDLCQRMPTWRALPDWAM
ELLVEKALSSASGPLRPGDAMRRVLECVATGTLLTDGPGLQDPCEKDQIDVLEVMTSQER
EDVTISAQHALRMLAFRQIHKVLGMDPLPPPKSRVGSRNRKRRRDFSEAVEGESGGKKER
KEDENNA
Download sequence
Identical sequences F6X204
ENSMODP00000000807 ENSMODP00000000807

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]