SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000890 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000000890
Domain Number - Region: 142-147,243-315
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000314
Family Formin homology 2 domain (FH2 domain) 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000890   Gene: ENSMODG00000000742   Transcript: ENSMODT00000000908
Sequence length 818
Comment pep:known_by_projection chromosome:BROADO5:2:484314579:484371370:-1 gene:ENSMODG00000000742 transcript:ENSMODT00000000908 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METWLRHPTEIEWELPLPSSTIRVEGKLGGGGCRRNFKAQRALRGQRLRDERTGGRSGHL
NVCVGEMAAQVGAVRVVRAVAAPEEPDKGGKEKPRPGASPRGTKRQRRASSGGPREKRGR
PNQDPPPAPPYRRRRSRQQPGPPPPPPAAASTVPSPSEPLLLTPPPPPSLAPAGPPLAAP
LAASALFTFSPLTVSAVGPKHKGHKERERHRHHHHHGSDPGSSGVAGPKHKGKRENGDQS
GGLSSAKAPKRETPDENGKTQRADDFVMKKIKKKKKKKHREDMRGRRLKMYNKEVQTVCA
GLTRINKEILTQGQVNNSSGVNKESFRYLKDEQLCRLNLGMQEYRVPQGVQTPFMTHQEH
SIRSNFLKTGTKFSNFIHEEHQSNGGALVLHAYMDELSFLSPMEMERFSEEFLTLTFSEN
EKNAAYYALAIVHGAAAYLPDFLDYFAFNFPNTPVKMEILGKKDIETTTISNFHTQVNRT
YCCGTYRAGPMRQISLVGAVDEEVGDYFPEFLDMLEESPFLKMTLPWGTLSSLRLQCRSQ
SDDGPIMWVRPGEQMIPTADMPKSPFKRRRSMNEIKNLQYLPRTSEPREVLFEDRTRAHA
DHVGQGFDWQSTAAVGVLKAVQFSEWSNQPRITKDVICFHAEDFTDVVQRLQLDLHEPPV
SQCVQWVDEAKLNQMRREGIRYARIQLCDNDIYFIPRNVIHQFKTVSAVCSLAWHIRLKQ
YHPVVEGPQNAENNANIDFGITAKSESEANSQCVSLKTESEGTNAETQLLTTASSSFSTS
SGLVQQDQGVQLLPAVKLEPSLESDQPHDPQDHPSIPV
Download sequence
Identical sequences F6VPY4
ENSMODP00000000890 ENSMODP00000000890 XP_007485226.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]