SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000968 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000968
Domain Number 1 Region: 35-143
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000759
Family Formin homology 2 domain (FH2 domain) 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000968   Gene: ENSMODG00000000813   Transcript: ENSMODT00000000987
Sequence length 202
Comment pep:known_by_projection chromosome:BROADO5:5:211588802:211597927:-1 gene:ENSMODG00000000813 transcript:ENSMODT00000000987 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGGEASCLRMLLGEVSPKMAASLGGMFGAQQPGPPPPPPPPGPPGSSGQVALLPTAAGG
PRNSNNTLVDELEASFEACFASLVSQDYVNGTDQEEIRTGVDQCIQKFLDVARQTECFFL
QKRLQLSVQKPEQVIKEDVSELRNELQRKEALVQKHLAKLRHWQQVLEEINIQHKKPTEI
PQGPLAYLEQASANIPAPMKQT
Download sequence
Identical sequences F6S9Q4
ENSMODP00000000968 ENSMODP00000000968

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]