SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000000992 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000000992
Domain Number 1 Region: 1042-1086
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000433
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 1075-1111
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000147
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000000992   Gene: ENSMODG00000000851   Transcript: ENSMODT00000001011
Sequence length 1112
Comment pep:known_by_projection chromosome:BROADO5:7:131805432:132151065:1 gene:ENSMODG00000000851 transcript:ENSMODT00000001011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRKIPKELKKVNISSSLESEDISLETTVPTDEISSSEEREGKTIITRQLIERKELLHNI
QLLKIELSQKNLIIDNMKVDYLTKIEELEEKLNDTLHQKQLLALKLDNQLTFQKKDTRKY
QELMKQEMETILLRQKQLEETNHQLIEKAGDIRRSLRDLELTEDHYMNLKSLPEDQLSIP
EYVSIRFYEVVNPLKREVNELQVKRNDLSEELIDYKSQLKRLLETYEDERRNHSELQVRC
QRLTLELADTKQLIQQGDYRQENYDKVKSDRDALEQELSDFRRKHEILEASYKAQTKERN
DLSKEVATLQQSLTLLQKDKEYLHRQNMELNIRCAHEEDRIERLQVQLEEAKKAREEMYE
KYVTSRQHHYLYKTEYESRLRDELEQIKLKTNQEIEHLRSTSKEMYERENRNLREARDNA
LAEKDRAVTAEKDALEKHDQLLEQYRELQLSSESKVAEFLHQSKLKSFESERAQLVQEET
ARNLTQCQLECDKYQKKLEVLTKEFYGLQASSEKRISELQAQNADHQTRLDNYEKLEKEL
DEIIIQTAEIENEEEAERVLFSYGYGANVPTTAKRRLQQSVHLARRLLQLEKQNSLFVKD
LEHQKEQVTQISQELERANSLLNQTKQPYRYLIESVRQRDSKINEQNERISQLETDISYL
HKEKAALIQIKNQLAVDLEQLLSHREELAVMKRTLINMHSKRRGDKLSATKNEAKLTIEI
PNPIDLPKENEENIFTPKPTVFTRCEMEKYLTPQLPPVTIIPEHKKYRRDSASVVDQFFT
DSEGLPYSINMNVFLPDITHLRTGLYKTQRPCVTHIKTEPVTIFSHQSETTAPAPAPTQA
LPEFTSIFSSHQTATPDVNNIFIKQELPTPDLHLSVTPQQGQLYQLLSSPDLDMPSSTNQ
TAVMDTLNVSMPAAMAGLNTLTSAVPQTAMKQFQGMPPCTYTMPNQFLPQQATYFPPSPP
SSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPATLPINSPNIQTVRYNRRSNP
DLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWRFARSDELTRHYR
KHTGAKPFQCAVCNRSFSRSDHLALHMKRHQN
Download sequence
Identical sequences F6RPZ8
ENSMODP00000000992 ENSMODP00000000992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]