SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001013 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001013
Domain Number 1 Region: 394-438
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000135
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 2 Region: 427-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000499
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001013   Gene: ENSMODG00000000851   Transcript: ENSMODT00000001032
Sequence length 464
Comment pep:known_by_projection chromosome:BROADO5:7:132127430:132151065:1 gene:ENSMODG00000000851 transcript:ENSMODT00000001032 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATRVLTMSARLGPVPQQQQQQPPQDEPVFAQLKPVLGAGNAAREAALFPGEEMKHPHHH
PHHPQQPQQQPPQQQQQQQPQPGSTRLPAEELVQTRCEMEKYLTPQLPPVTIIPEHKKYR
RDSASVVDQFFTDSEGLPYSINMNVFLPDITHLRTGLYKTQRPCVTHIKTEPVTIFSHQS
ETTAPAPAPTQALPEFTSIFSSHQTATPDVNNIFIKQELPTPDLHLSVTPQQGQLYQLLS
SPDLDMPSSTNQTAVMDTLNVSMPAAMAGLNTLTSAVPQTAMKQFQGMPPCTYTMPNQFL
PQQATYFPPSPPSSEPGSPDRQAEMLQNLTPPPSYAATIASKLAIHNPNLPATLPINSPN
IQTVRYNRRSNPDLEKRRIHYCDYPGCTKVYTKSSHLKAHLRTHTGEKPYKCTWEGCDWR
FARSDELTRHYRKHTGAKPFQCAVCNRSFSRSDHLALHMKRHQN
Download sequence
Identical sequences F7BI98
ENSMODP00000001013 XP_001362386.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]