SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001027 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001027
Domain Number 1 Region: 311-355
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000992
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 2 Region: 343-380
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000655
Family Classic zinc finger, C2H2 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001027   Gene: ENSMODG00000000863   Transcript: ENSMODT00000001047
Sequence length 382
Comment pep:known_by_projection chromosome:BROADO5:7:132919648:133427843:-1 gene:ENSMODG00000000863 transcript:ENSMODT00000001047 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNIYMKRKTIKKISTFENRMLMLDGMPAVRVKTELLESEQGSPNVHNYPDMEAVPLLLNN
MKTEPPEDSLSTDHFQTQTEPVDLSINKARTSPTAVSSSPVSMTASASSPSSTSTSSSSS
SSRPASSPTVITSVSSASSAPTVLTPGPLVASASGVGGQQFLHIIHPVPPSSPMNLQSNK
LSHVHRIPVVVQSVPVVYTAVRSPGNMNNTIVVPLLEDGRSHVKAQMDPRGLSPRQIKSD
SDDDDLPNVTLDSVNETGSTALSIARAVQDSISPFSIESTRRQRRSESPDSRKRRIHRCD
FEGCNKVYTKSSHLKAHRRTHTGEKPYKCTWEGCTWKFARSDELTRHYRKHTGVKPFKCA
DCDRSFSRSDHLALHRRRHMLV
Download sequence
Identical sequences F7BHP0
ENSMODP00000001027 XP_007501503.1.35504 XP_007501504.1.35504 XP_007501505.1.35504 XP_007501507.1.35504 XP_007501508.1.35504 XP_016280469.1.35504 XP_016280470.1.35504 ENSMODP00000001027

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]