SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001225 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001225
Domain Number 1 Region: 744-878
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.000000314
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.014
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001225
Domain Number - Region: 482-487
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0146
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001225   Gene: ENSMODG00000001029   Transcript: ENSMODT00000001250
Sequence length 899
Comment pep:known_by_projection chromosome:BROADO5:2:24558777:24719654:-1 gene:ENSMODG00000001029 transcript:ENSMODT00000001250 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTRLDQHRLKKRTRKAFGIRKKEKDTDSTGSPDRDGIQGKKKAQKTQLLLSPCFWLRALS
LTLFQLPPRLAREGSHLPWNAGGKSDLPTLNRARIAGSRPCRWWSISSQNGDRSEGKRHP
SPHEPPYNSKAEYAREGGKKVSKKSNGAPNGFYAEIDWERYNSPELDEEGYSIRPEEPGS
TKGKHFYSSSESEEEEESHKKFNIKIKPLQSKDVLKSAATVDELKASIGNIALSPSPVRK
SPRRSPGAIKRNLSSEEVARPRRSTPTPELVSKKAPEDPVALAPLFGPPLESTFEEQKSE
VPLDQPEIWGSVQPVNASLESPKLTRPFPTGTPPPLPPKNVPATPPRTGSPLTVGPGSEQ
TTHEVKGDKLPSISDLDSIFGPVLSPKSVVVNTEEKWVNFSDASPERVTPELTSREKVAS
PPPVSENPADIPAGDPPRNIPSPLDLEEVQKKFSEQTLGKDDYLETVASPKDLGLGQRAT
PPPPPPPTYRTVVSSPGPSSGSGTGTASGASSPARPATPSAHCSSGTTPPPPPPRPPSRP
KLPPGKPGVGDVSRPFSPPIHSSSPPPIAPLARAESTSSISSTNSLSAATTPTVENEQPS
LVWFDRGKFYLTFEGSSRGPSPLTMGAQDTLPVAAAFTETVNAYFKGADPSKCIVKITGE
MVLSFPAGITRHFANNPSPATLTFRVVNFNRLEHVLPNPQLLCCDDAQSDANTKEFWVNM
PNLMTHLKKVSEQKPQATYYNVDMLKYQVSAQGIQSTPLNLAVNWRCEPASTDLRIDYKY
NTDAMTTPVALNNVQFLIPIDGGVTKLQAVLPPAVWNAEQQRILWKIPDISQKSENGGVG
SLLARFQLSEGPSKPSPLVVQFTSEGSTLSGCDIELVGAGYRFSLIKKRFAAGKYLADN
Download sequence
Identical sequences F6ZF61
ENSMODP00000040255 ENSMODP00000001225

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]