SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001260 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001260
Domain Number 1 Region: 553-877
Classification Level Classification E-value
Superfamily WD40 repeat-like 5.58e-99
Family WD40-repeat 0.00000000000579
Further Details:      
 
Domain Number 2 Region: 449-548
Classification Level Classification E-value
Superfamily F-box domain 4.58e-28
Family F-box domain 0.00000102
Further Details:      
 
Domain Number 3 Region: 201-231
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00000256
Family beta-sandwich domain of Sec23/24 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001260   Gene: ENSMODG00000001062   Transcript: ENSMODT00000001287
Sequence length 892
Comment pep:known_by_projection chromosome:BROADO5:5:125018260:125163431:1 gene:ENSMODG00000001062 transcript:ENSMODT00000001287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTSSVGLEAAAAAAVAAVAETAAEAAVAVAAAATAATAAAAAATAAAAAVAAAAVAAAAT
AAAAATAVAVSAAATAAAAAATRISDAKLKDEKGERTVILDLSRKSLQSVAYWIGIGPEV
RSSVPNSSTDLQFDFGQNVKTFASSDSLAKVQEVASWLLEMNQELLSVGSKRRRTGSSLR
GNSSSSQVDEDQMNRVVEEEQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQLRQEEEHIAR
NGEVIGAEPRHGDQNDSQQGQLEENNNRFISVDEESTGIQEEQEDEEEHAGEQDEEDEEE
EEMDQESDDFDQSDDSSREDEHTNSNSVTNSNSIMDLPIHQLSSPFYTKTSKMKRKLDHG
SEVRSFSLGKKPCKVSEYTSTTGLVPCSATPTTFGDLRAANGQGQQRRRITSVQPPTGLQ
EWLKMFQSWSGPEKLLALDELIDSCEPTQVKHMMQVIEPQFQRDFISLLPKELALYVLSF
LEPKDLLQAAQTCRYWRILAEDNLLWREKCKEEGIDEPLHIKRRKIIKPGFIHSPWKSAY
IRQHRIDTNWRRGELKSPKVLKGHDDHVITCLQFCGNRIVSGSDDNTLKVWSAITGKCLR
TLVGHTGGVWSSQMRDNIIISGSTDRTLKVWNAETGECIHTLYGHTSTVRCMHLHEKRVV
SGSRDATLRVWDIETGQCLHVLMGHVAAVRCVQYDGRRVVSGAYDFMVKVWDPETETCLH
TLQGHTNRVYSLQFDGIHVVSGSLDTSIRVWDVETGNCIHTLTGHQSLTSGMELKDNILV
SGNADSTVKIWDIKTGQCLQTLQGPNKHQSAVTCLQFNKNFVITSSDDGTVKLWDLKTGE
FIRNLVTLESGGSGGVVWRIRASNTKLVCAVGSRNGTEETKLLVLDFDVDMK
Download sequence
Identical sequences F6YR23
ENSMODP00000001260 ENSMODP00000001260

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]