SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001270 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001270
Domain Number 1 Region: 276-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000238
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 2 Region: 916-968
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000474
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 3 Region: 752-798
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000839
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number 4 Region: 411-461
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000722
Family Classic zinc finger, C2H2 0.02
Further Details:      
 
Domain Number 5 Region: 973-1022
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000144
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 6 Region: 883-924
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000274
Family Classic zinc finger, C2H2 0.021
Further Details:      
 
Domain Number 7 Region: 790-848
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000974
Family Classic zinc finger, C2H2 0.031
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001270
Domain Number - Region: 318-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000563
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Domain Number - Region: 453-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00691
Family Classic zinc finger, C2H2 0.043
Further Details:      
 
Domain Number - Region: 362-385
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0274
Family Classic zinc finger, C2H2 0.023
Further Details:      
 
Domain Number - Region: 11-35,118-143
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0877
Family Classic zinc finger, C2H2 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001270   Gene: ENSMODG00000001068   Transcript: ENSMODT00000001297
Sequence length 1252
Comment pep:known_by_projection chromosome:BROADO5:3:414122354:414441533:-1 gene:ENSMODG00000001068 transcript:ENSMODT00000001297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METQAADHHSIFMCKFCNLFSPSQSELLSHASEKHKEEGVNINEIIIPLRPLTTTEPSNQ
NKSGEELLVVKRKRGRPKGSTKKLCPDEESTENNNRSPNEENQLALPEGNSLPEVTEVVP
DNLECHKCCRKFSNTRQLRKHICIIVLNIEEEGDPGNDSEVELDRKDKEDEREKAPKRSR
TQKAEKVQKISSGKETVQFSGAKKPIISVVLTAHEAIPGATKIVPVEAGPPESEATNTKA
TIPDLAHRRGYQEYAIQQTPYEQPMKSSRLGPTQLKIFTCEYCNKVFKFKHSLQAHLRIH
TNEKPYKCSHCSYASAIKANLNVHLRKHTGEKFSCDYCVFTCLSKGHLKVHIERVHKKIK
QHCRFCKKKYSDVKNLIKHIRDTHDLQDKKVKEAFDELRLMTREGKRQLLYDCHICERKF
KNELDRDRHMLVHGDEWPFACELCGHGATKYQALELHVRKHPFVYVCSVCLKKFVSSIRL
RSHIREVHAVLQETVVFNDSINQSFCLLEPGGDIQQEAVVGDQLPPTGGEFVFQALDPKK
ETSSLGEANQENGSRHISHVEIPTTSLDLENPQGANVMVPSCGLATDVATSELHSHVVSE
DFLLKSNTSAPADTQVSSKDDLQGQPGDSANTIQGEEITLLLPRDKNSEPNRENTSNENH
VAEEENIVALSLTELEARTSPAPNSTQATELLPSTATSGDTHISPQSDSCPTSSSEHRTR
TAAFMQVLDNLQKRQMNTSMCERIRKVYGDLECEYCGKLFWYQVHFDMHVRTHTREHLYY
CSQCNYSSITKNCLKRHVIQKHSNILLKCPTEGCDYSTPDKYKLQAHLKVHTELDKRNYS
CPVCQKSFSEDRLIKSHIKTNHPEVSMNTISEILGRRVQLKGLIGKRAVKCPYCDFYFMK
NGSDLQRHIWAHEGVKPFKCSLCEYATRSKSNLKAHMNRHSTEKTHLCDMCGKKFKSKGT
LKSHKLLHTADGKQFKCTVCDYTAAQKPQLLRHMEQHASFKPFRCAHCHYSCNISGSLKR
HYNRKHPNEDYVNVGTGELAADALIQQGGLKCPVCSFVYGTKWEFNRHLKNKHRLKLMES
DGDTKWELATEVSEESSTQYLHITEAEEDVQGTQAAVAALQDLRYTSENGERLDPTAVNI
LQQIIELGTETHDAAAVASVVAMAPGTVTVVKQVTEEEQSANHTVMIQETLQQASVELAE
QHHLVVSSDDVEGIETVTVYTQGGEASEFIVYVQEALQPVEEQTVEHSAQDM
Download sequence
Identical sequences F6YQK1
ENSMODP00000001270 ENSMODP00000001270 XP_007488431.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]