SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001304 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001304
Domain Number 1 Region: 229-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000138
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001304   Gene: ENSMODG00000001086   Transcript: ENSMODT00000001332
Sequence length 347
Comment pep:novel chromosome:BROADO5:1:194897367:194908038:1 gene:ENSMODG00000001086 transcript:ENSMODT00000001332 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCMLHRGKTQDMYVSKINTKDMERLRNFERMVMRSHKHVTYMLTSHIGQIRSLQRAGKLK
LQHLSSSQMDLRDLLTKPQGQKLQQTTGNNLDNRAGKPAPFQLLLSSGEDLNNLIIQQNR
EKAPSGQNNPNPQIQYIMRGARLQRTTEKKIMVNKKVEGLNFRYESKYSKCFPEEVGLVQ
LPEKPPEMSMDQGNLGRMTFGWCLVLRYPKSKCVKMVSMSNKSRRPSSQNSKLDVHQRIY
TGEKANECKQCGKAFTRKSTLAIHQTTHTGDNLMNVNNAVRLSLLGAILLCIREFTLGRN
LMNVNNMERLSQSITFLPEKPQEDIPEMMQRKVSRTKKAIYTVTTTL
Download sequence
Identical sequences F7DPP3
13616.ENSMODP00000001304 ENSMODP00000001304 ENSMODP00000001304

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]