SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001325 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001325
Domain Number 1 Region: 102-509
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 4.19e-103
Family Formin homology 2 domain (FH2 domain) 0.0000131
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001325   Gene: ENSMODG00000001112   Transcript: ENSMODT00000001353
Sequence length 1195
Comment pep:known_by_projection chromosome:BROADO5:5:124307134:124363426:-1 gene:ENSMODG00000001112 transcript:ENSMODT00000001353 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVDWNLEEYDGRGSSIIGCSKCSSSQENTSLEGCSTMHVMNCVSLASEKENGEVSVAAGL
MIGQTPPPPPPPPPPPPPLPLPCPDNGCPPVPPPPPLPGGPPAPPPPPPPPPGLPPSSYV
NGHGHLSKKKKMRNFFWKTIPEEQVRGKTNIWTIAERQSQKYQIDTKTIEELFGQQEDTK
SFVSRRGGTLNASFKEAKEEVSVLDAKRCMNIGIFLKQFKKSPQSIVEDIHQGNGEHYGS
ETLREFLKLLPESEEVKKLKTFSGDAAKLSLADSFIYLLIQVPNYSLRIEAMVLKKEFLP
SCSSLWDDMSTLRMATKELMSCEELHSILHLVLQAGNIMNAGGYAGNAVGFKLSSLLKLA
DTKANKPGMNLLHFVALEAQKKDAVLLNFSEKLRHVQVAARLSLDNTESELHSLSTRTKS
LKENIQRDPELCQQMKAFIKFALQKLEELERWREELQKEAHALIDFFCEDKETMKLDECL
QIFRDFCTKFDKAVKDNRDREIQEFRQLQKLKGLEEKRRSWAAGELGGFGRSSSENDVEL
LTKKGLEDFLPFLHQRPVSPSHRPPNARRSRLSLGTSADRELLTFLETSTGEDLNKFNSL
PRTSTRQARPSVAWMEPTEPKDVNSNHLHFYPAPETEKVCNNPPPSQPGQFLNPCLENSN
AILYCTQSHANNSNLQRDSGPGAQPLASFPPLSTLTMGIEARELAHGLIQFDLQEPASQE
EPPRFTSEDSSPGESESLDDASLPSLTAGDDIPVPIGKDSKKVTGRENGAMVPKDMVADV
TVSSSTVPASPDKSESESKEAGPIFYISDTTDCSLTLDCSEGNDPQVGSHESKMGKPVNG
SVTSDPGDTEGETSSSRVPSIPNFSPTREDSTLALGKNEPGDKCGLPREKVVKGKEAAGP
KRNSLKDTPMSAPKPGSMRRSLGPPSKPVRTLNASENESMRKVVPISKSSRGSGSWKRPE
VPARVTPREAPSNTESRMSRRSSVRGTADTSPRRPSGVAVAAAVAAEEQRLQRGNAMSSS
IRLGKDYPLQHKTSLKKPSAKPIRNLPKPKADETKICRTNPQESEDAEEAPKPPPPVPRV
PPPIPSFARNTVASSSRRLKTDLPPVSKVPGITRAASQRQLRMKTAPEDTQTKNGSSLKR
SSSARTAQKCPEPSESTSGKGETSLKGRGTGEKSSLKRKDSNRTTLGKILNPLWK
Download sequence
Identical sequences F7DPE4
ENSMODP00000001325 XP_007496287.1.35504 XP_007496288.1.35504 XP_007496290.1.35504 XP_007496291.1.35504 ENSMODP00000001325

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]