SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001456 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001456
Domain Number 1 Region: 182-239
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.45e-25
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 2 Region: 406-463
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.94e-25
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 322-379
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.95e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 4 Region: 238-295
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.46e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 9-69
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.75e-22
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 6 Region: 476-528
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.51e-22
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 7 Region: 146-196
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.11e-18
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 8 Region: 285-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000968
Family Classic zinc finger, C2H2 0.0096
Further Details:      
 
Domain Number 9 Region: 369-401
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000017
Family Classic zinc finger, C2H2 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001456   Gene: ENSMODG00000024499   Transcript: ENSMODT00000001487
Sequence length 536
Comment pep:novel chromosome:BROADO5:7:260786713:260854726:1 gene:ENSMODG00000024499 transcript:ENSMODT00000001487 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFERNRLPAQEMVTFQDVAVDFTREEWCLLSPPQKELYKEVMLENARNLLSVGLPALPE
DVISYLEQREAPWMLEREGPRSCCPGEILLEMKVTPEDMSLSVEEMDKERLISDIPGNIA
WREFCVESQTSSHTEYQRMNSEEKSSECRQCGKIFSLRSSLAQHQRIHTRERPYQCKECG
KAFTLRSSLAQHQRIHTGEKPYECKQCGKTFTEYSTLAVHQRIHTGEKPYECKQCGKTFR
VRSSLAQHQRIHTGEKPYECKQCGKTFTECSTLSVHQRIHTGEKPYECKQCGKTFRVRSS
LAQHHRIHTGEKPYECKQCGKSFRLRSKLAQHHRIHTGEKPYECNQCGKSFRLRSSLAEH
QRIHTGEKPYECKQCGKTFTECSTLAVHQRIHTGEKPYECKQCGKTFRVRSSLAQHHRIH
TGERPYECKQCGKTFRVRSSLARHQRIHTGEKPYECKQCGKTFRVRSSLAQHHRIHTGER
PYECKQCGKTFRVRSSLARHQRIHTGEKPYECKQCGKSFSQSSHLTGHQRNHRLSH
Download sequence
Identical sequences F7G7R8
ENSMODP00000001456 ENSMODP00000001456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]