SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001591 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001591
Domain Number 1 Region: 200-248
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000268
Family Classic zinc finger, C2H2 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001591   Gene: ENSMODG00000001319   Transcript: ENSMODT00000001624
Sequence length 1103
Comment pep:known_by_projection chromosome:BROADO5:5:219879172:219929747:-1 gene:ENSMODG00000001319 transcript:ENSMODT00000001624 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPGTDYAEDRIPRISLTEGLELNTQLFLEMQIKKMKEIIPQLYTDQVNDKNNSLTTSPKQ
LANEHVSQPNGHESQSHGYQDSKAEDDKMCMVTCLRCRSLQKVPLQELKKDNQYSQIEDQ
MFFVCVKCTFGVSPPIPFMNDMPGSIDSGNKDATISRTITNQFKVKNFQPGKYYCDKCRF
STKDPLQYKKHTLQHEEIKFFCSHCSYVSYTKGEFQRHLVKHTGTFPYQCEYCDYGAVRN
DYIVKHTRRVHETSGEKRPLRQVMEHQPKRTNFSKQNSEVLVNEVSKSNSFLNEPTDSPL
YFPSHGDQDKTGPAISLPETKECSRDEAASAPDKACLPEPSKVNLFENENVEVELLSPAK
EPVQPGMPLTVVAPAELRVPENCLAQLIDVKVVNGTQQLVLKLIPMKEKNGFKLGSSDEG
KYEPMNKYTVPNEQEKLVPTEPTPPAMEGSPEKPLGINNLHSTDYTHAKDLDCIKSSDSQ
VLKNMSITNQCESCPNNDRVGNWRQEVLSFPYRTALSPVSSRDGHIEQNNFSSLSVMNNG
TLCSPVKRLSVLPTVAALSPCQERSQNHLEKPSSNSKPTEALVALAKRDTLPVNQEASLN
KKEVDTFKMVAFSEKLNQAQAKEPSGDPNSMQDSTLCRSEQSHINLIRENDIKTQDPEEV
MSEDLVGVALQNSGSNITSSDGPVISSVFSLSSGVENIPEGIKWDNACFRTKSFNSLQKK
IAQLIAATESSKTSLSPSSTVEQQSLPLETPLDCIQGHNAPSIDRVPPQALQNNATGIEL
LINEQMQHHNNVDEQTKAREVTDNHDAVSVFIPKDTGLKAFSSTENEHLVENKLPNGGNK
RELSKSVSFNFLEQIGEDLSLTNESQLIDSSRNFGTSLGNKPNQEYTTSTVSKKSDSSCP
QTKEDNNQDKQEKLTFSGPSGSKINTKQALISKKKNKIISDSSHMLPDVCIFMTARHLRL
IPLKTEQLIKCPRRNQPVVVLNHPDVDSVEVINVMKVVHKYKGNVLKVVLSERTCDQLGI
KRHHRRLIYQNLEAVCPVKKTMLKMKLKKIHKNSYQVQSMEAPIWAVSMNDRDVDIQESR
PDVAQQQQLEEQASGTAAEWKQQ
Download sequence
Identical sequences F7BDY9
ENSMODP00000001591 ENSMODP00000001591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]