SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001654 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001654
Domain Number 1 Region: 651-695
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000248
Family Classic zinc finger, C2H2 0.0015
Further Details:      
 
Domain Number 2 Region: 684-723
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000146
Family Classic zinc finger, C2H2 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001654   Gene: ENSMODG00000001368   Transcript: ENSMODT00000001688
Sequence length 774
Comment pep:known_by_projection chromosome:BROADO5:8:301864854:301923138:-1 gene:ENSMODG00000001368 transcript:ENSMODT00000001688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPEGGKTSEQENNNKKAKTSGSQDSQPSPLALLAATCSKIGTPGENQASGQQQIIIDPS
QGLVQLQNQPQQLELVTTQLAGNAWQLVTATPPSSKENNVSQAASSSASSTSSANENSPT
KAKPSQPSSSSSSSSGQFQVIQVQNPSGNVQYQVIPQLQAVEGQQIQINPGNATSLQDLQ
GQIQLIPAGNNQAILTAANRTASGNILAQNLANQTVPVQIRPGVSIPLQLQTIPGAQAQV
VTTLPINIGGVTLALPVINNVAAGGGSGQMGQSAADGGAPNGNQLVSTPTPTPPTTTASA
SSTMPESPSSSSTTCPASTASTTLTSSDPLVSSVDSGQYASASERALEEPQPPVPESEAQ
NSGQLQPNGLQNTAAAPQQEQASSLQQVQIVGQPILQQIQIQQPQQQIIQAIPPQSFQLQ
SGQTLQTIQQQPLQNVQLQAVSPTQVLIRAPTLTPSGQISWQTVQVQNIQSLPNLQVQNA
GLPQQLTITPVSSSGGTALAQIAPVAVAGAPITLNTAQLASVPNLQTVSVANLGAAGVQV
QGVPVTITSVAGQQQGQDGVKVQQATIAPVTVAVGGLANATLGAVSPDQITQLQQAQQTS
EQEVQPGKRLRRVACSCPNCREGEGRGTNEPGKKKQHICHIEGCGKVYGKTSHLRAHLRW
HTGERPFVCNWIFCGKRFTRSDELQRHRRTHTGEKRFECPECSKRFMRSDHLSKHVKTHQ
NKKGGGTALAIVTSGELDASVTEVLGSPRIVTVASISQDSNPATPNVSTNMEEF
Download sequence
Identical sequences F7FVV4
ENSMODP00000001654 ENSMODP00000001654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]