SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001662 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001662
Domain Number 1 Region: 247-291
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.68e-16
Family Classic zinc finger, C2H2 0.0018
Further Details:      
 
Domain Number 2 Region: 280-317
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000116
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001662   Gene: ENSMODG00000001375   Transcript: ENSMODT00000001696
Sequence length 369
Comment pep:known_by_projection chromosome:BROADO5:8:302548059:302549209:1 gene:ENSMODG00000001375 transcript:ENSMODT00000001696 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SVFQAPGVSGGGGGGGGGGGGGGGAHSQDGSHQPVFLSKVHTSVDGLQGIYPRVGMAHPY
ESWFKPSHPGLGAAGDVGAAGAASSWWDVGAGWIDVQNPNGAAALPGSLHPAAGGLQGSL
HSPLGGYNSDYSGLGHSAFSSGASTHLLSPAGQHLMDGFKPVLPGSYPDSAPSPLAGAGG
SMLGGGGPAAPLGGSPRSSARRYSGRATCDCPNCQEAERLGPAGASLRRKGLHSCHIPGC
GKVYGKTSHLKAHLRWHTGERPFVCNWLFCGKRFTRSDELQRHLRTHTGEKRFACPVCNK
RFMRSDHLSKHVKTHSGGGGSGGGGSAGSGSGGKKGSDTDSEHSAAGSPPCHSPELLQPP
EPGHRNGLE
Download sequence
Identical sequences F7FJC6
ENSMODP00000001662 ENSMODP00000001662

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]