SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001710 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001710
Domain Number 1 Region: 125-220
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 2e-39
Family Forkhead DNA-binding domain 0.0000035
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001710
Domain Number - Region: 321-338
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0068
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001710   Gene: ENSMODG00000001413   Transcript: ENSMODT00000001745
Sequence length 514
Comment pep:novel chromosome:BROADO5:2:7154315:7155889:-1 gene:ENSMODG00000001413 transcript:ENSMODT00000001745 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTLGGCCCEIMSSESSPAVLSEAEGDIDVVGGGGGGGDPLLSAAITPRDACKYGPEEEEG
DEEEEEEEGESSDGEPRLLPPPTPRGAGPKGGAEPSPGGEPPVAPRGAAAGADKAPSGAG
KNPLVKPPYSYIALITMAILQSPKKRLTLSEICEFISGRFPYYREKFPAWQNSIRHNLSL
NDCFVKIPREPGNPGKGNYWTLDPESADMFDNGSFLRRRKRFKRQPLPPTHTHAHHPHAH
PHPELLLRGGDPGAFLPGFAAYGAYGYSYGLPLPGYHAHHAGPPQPQHPHPAPHTGHPAA
FSFAAAAAAAPCPLAAPPPAPPPPPPPPPPPVQSQTAPASAPAPGPPTAAASLFAATPAG
LPSFLGADLGCRKAFYPAQLSPPAAGTATSLPAAAAAAALLHSLKADSGGGGGGGGGGGS
GGSGSAGRPSFSIDHIIGSGGGGNGGGTGAGGGSPSSPYATAPSGGQAQVLAVLPAPALT
PVPAHFRLSHPGDALLQSGPNFASKIPSLSGCHF
Download sequence
Identical sequences F7BD12
13616.ENSMODP00000001710 ENSMODP00000001710 ENSMODP00000001710

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]