SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001744 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001744
Domain Number 1 Region: 715-720,759-1154
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 2.09e-95
Family Formin homology 2 domain (FH2 domain) 0.0000689
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001744   Gene: ENSMODG00000001441   Transcript: ENSMODT00000001781
Sequence length 1193
Comment pep:known_by_projection chromosome:BROADO5:1:188611000:188966780:1 gene:ENSMODG00000001441 transcript:ENSMODT00000001781 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDGAGSPNGSDGPTPEHSTEDGIEITQSILSKFSMKSFFGFTTKLESTKPAEEDAVLKA
FRNLGPEPLLQLESNNKDQETKAQFPPALLNCKDNTIGESAPEKEGCPEKEQDGGFLLSE
EPHPSSPLSSSRDDDILVHGTLVRTTSDSESEGEGLEEKEGKNIGSTIPHSSVSSGPSVD
PKEIPGETRRNETLNEMNKMELSIEVCSSMPSELMNDLEQNGAVLSIGLDPKQDHPGEDS
PAEVGGEDKSTFSENPENASPKKEGSGEKSFQLPAFFSGLRVLKKGATSEGEETITEIKP
KDSDLALLKLTQPVQKSRVLPGTLSRKSGEKTSDLKATPTLLEQISQLLNIDMPKTEQKG
EVCEQAKEEEMGSDTDQESQCKTEVPSQNEEVKPKPPETALEAFKALFMRPPKKGSTADT
SELEAIKRKMRHEKESLRAVFERSKSRSGDGSSDSRSADQSPTEQDDRTPGRLQAVWPPP
KTKDEEEKVGLKYTEAEYQAAILHLKREHKEEIENLQAQFELRVFHIRGEHAVITARLEE
TIENLKCELEHRLSGGCDKTRDVCISTEDDNPPKTFRNVYIQTDRETFLKHNEDESKTIK
SNQIVPKKLNISSLNHISPPNDNKDTTSIFQSLESCPSSQQQSSPIPAPPLPIIIPAPPP
LPPGLGPPPSLSQSSAGPPPPPPPPPSLPLPISAGTPPPPPPLPIPPPLPSTGPPPPPPP
APPGIGTPPPPPPFFGGNTSFSQIPRKPAIEPSCPMKPLYWTRIQISGGSQSTTPTLWDS
LEEPDIQDPSEFEYLFSKDTIQQKKKPLSESFEKKTKVKKIVKLLDGKRSQTVGILISSL
HLEMKDIQQAIFNVDDSVVDLETLEALYENRAQKDELIKIRKHYETSKEEELKLLDKPEQ
FLYELAQIPNFAERAQCIIFRSVFSEGITSVHRKVEIITRASKGLLDMKSVKDILALILA
FGNYMNGGNRTRGQADGYSLEILPKLKDVKSRDNGINLVDYVVKYYLRYYDSEAGTEKSI
FPLPEPQDFFLAAQVKFEDLIKDLRKLKRQLEASEKQMVIVCKESPKEHLQPFKDKLEVF
FQKAKGEHKMEETHLENAQKSFETTVGYFGMKPKSGEKEITPNYVFMVWYEFCSDFKTIW
KRESKNISKERLKMAQETVNKLTAEKKVETKKINPTASLKERLRQKEASVTTN
Download sequence
Identical sequences F7BC74
ENSMODP00000001744 XP_007480059.1.35504 ENSMODP00000001744

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]