SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001755 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001755
Domain Number 1 Region: 505-562
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.17e-25
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 2 Region: 449-506
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.96e-25
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 561-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.77e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 617-674
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.1e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 393-450
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6e-24
Family Classic zinc finger, C2H2 0.0072
Further Details:      
 
Domain Number 6 Region: 34-94
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.09e-22
Family KRAB domain (Kruppel-associated box) 0.00089
Further Details:      
 
Domain Number 7 Region: 337-394
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.03e-22
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 8 Region: 659-711
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.41e-20
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 9 Region: 253-310
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000787
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 216-265
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000001
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 11 Region: 301-329
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000895
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001755   Gene: ENSMODG00000022831   Transcript: ENSMODT00000001792
Sequence length 720
Comment pep:novel chromosome:BROADO5:Un:9346176:9500052:-1 gene:ENSMODG00000022831 transcript:ENSMODT00000001792 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAASLLPRKRRQRACRGPRTSARGVAPGSPGPPAQVLVTFQDVAVDFTQEEWRLLDPGQ
KELYKEVMLENVQNVLSLGLPVPREDWISHSDWGEAPWMLEGEGPSSSCVDGERRLGMRE
TNAKLREESQQPRFMNDYHCDFNLREICVSNFKIEKTQKVHSEFDNGKNIRRYSILIQRK
KMISSNDTSQDSKYRECFTEQVEFVESHEKPPVLQTYQCNNCEMTFNLKSELITHQKSHA
GEMLYTHNAVEEAFSHNSELTDHHKIQNGKKHYEYNNYGKAFKKQLSLIHHQKFHTSTKL
HKCMQCGQAFRRQSSLISHQKIHTRETSYDYHKCINTFSEKSSLIVCERSLTGEKPYECE
QCGKTFTQGSHLDIHKRIHTGEKPYECNQCGKTFRFNSKLTQHQRMHTGEKPYECNQCGK
SFKQKYSLTAHQGIHTGEKPYQCHQCGKTFRCSSSLAQHQRIHSGEKPHECNQCGKAFTN
TSHLAVHQRIHTGEKPYKCKQCGKTFTQSSHLDIHTRIHSGGKPYECNQCGKTFTNTSNL
AVHQRIHTGEKPYKCNQCGKAFTQGGYLTEHQRIHTGEKPYECNQCGKTFRCNSGLANHQ
RIHTGAKPYECNQCGKSFTHNFHLASHQRVHTGEKPYECNQCGKAFTNTSNLHKHQRIHT
GEKPYDCKQCGKTFRCRSSLAQHQRIHTGEKPYECIHCGKAFTNTSNLHKHQRIHTGEKS
Download sequence
Identical sequences H9H5X5
ENSMODP00000001755 ENSMODP00000001755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]