SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001757 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001757
Domain Number 1 Region: 656-713
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.64e-19
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 2 Region: 713-769
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000661
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 3 Region: 619-670
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000163
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000001757
Domain Number - Region: 451-577
Classification Level Classification E-value
Superfamily SET domain 0.000294
Family Histone lysine methyltransferases 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001757   Gene: ENSMODG00000001448   Transcript: ENSMODT00000001794
Sequence length 833
Comment pep:known_by_projection chromosome:BROADO5:8:87098958:87124544:-1 gene:ENSMODG00000001448 transcript:ENSMODT00000001794 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGATLKDPSLLWGILPEANSDSADHCLPLFPRMNEMNLSPVGMEQLASSSVSNALPVSG
SHLGLATSPTHNAIPAPGLPVAIPNLGPSLSSLPSALSLMLPMGIGDRGVMCGIPERNYP
LPPPPYPHLESSYFRHILPGILSYLADRPPPQYIHPNSISVDNNPALAVSNNPSALDPYQ
PGGNVGLEAGIVPMDSRAVSGHGTQNLHSADTHEVALDTAITMESVSRVTSPISTDGMAA
EELTMEGVAGEHSQMPNGSRSHEPLSVDSVGNNLAADAVGHGGVLPLHGNGLELPVVMET
DHIAGRVGGMPDSTLSDSMHTVAMSTNSVSVALSTSHSLASLESVSLHEVGLSLEPVAVS
SITQEVAMGSGHVDVASDNLSFVPPSLQMEDSNSNKENMATLFTIWCTLCDRAYPSDCPD
HGPVTFVPDSPIESRARLSLPKQLVLRQSLMGADVGVWTGETIPVRTCFGPLIGQQSHSM
EVADWTDKAANHIWKMYHNGVLEFCIITTDENECNWMMFVRKARNREEQNLVAYPHDGKI
YFCTSQDIPPENELLFYYSRDYAQQIGVPEHPDVHVCNCGKECNSYTEFKAHLSSHIHHH
LPSQSHGAGHGPNHSKERKWKCSMCPQAFISPSKLHVHFMGHMGMKPHKCDFCSKAFSDP
SNLRTHLKIHTGQKNYRCVLCDKSFTQKAHLESHMVIHTGEKNLKCDYCDKLFMRRQDLK
QHVLTHTQERQIKCPKCEKLFLRTNHLKKHLNSHEGKRDYVCEKCSKAYLTKYHLTRHLK
ICKGPTSGSSAQEEDDDDDSEEEEPGDSVGAEECRLGGAVYAAATDDGLSTHK
Download sequence
Identical sequences F7BBW4
ENSMODP00000001757 ENSMODP00000001757 XP_007503432.1.35504 XP_007503433.1.35504 XP_007503434.1.35504 XP_007503435.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]