SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000001972 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000001972
Domain Number 1 Region: 535-591
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 2 Region: 366-423
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.58e-24
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 646-703
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.09e-24
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 4 Region: 478-535
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.07e-23
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 5 Region: 422-479
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.93e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 590-647
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 7 Region: 690-750
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.61e-21
Family Classic zinc finger, C2H2 0.0034
Further Details:      
 
Domain Number 8 Region: 34-93
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.66e-21
Family KRAB domain (Kruppel-associated box) 0.001
Further Details:      
 
Domain Number 9 Region: 272-324
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000803
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 310-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000149
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 11 Region: 217-261
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000491
Family Classic zinc finger, C2H2 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000001972   Gene: ENSMODG00000022830   Transcript: ENSMODT00000002014
Sequence length 751
Comment pep:novel chromosome:BROADO5:Un:9502265:9526049:-1 gene:ENSMODG00000022830 transcript:ENSMODT00000002014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPAASLLPRKRRQKACRRPRPGARRMAPGSPSTPAQVLVTFQDVAVDFTQEEWRLLDPGQ
KELYKEVMLDNAQNMLFLGLPVPREDWFSHFHEGGASWMLEGEDPSNSGLDGERRLEMRE
TNAKLMEESQELTFMNDDSCDFSLTEICDSDFTIEKTEEVHHKIDKNGKNIRQYSILIRR
KKMISGNDYSQDSKYRECFTEQVEFVESHEKSPVLQTYQCNNCEMTFTVKSELITHQKSH
AGEMFYTHNEVEEAFSHNSELSDNQKTQNGKKHYECNDCGKAFKKQSSLIQHQKFHTSTK
LHKCMQCGQAFRRQSSLRSHQKIHTRETPNEYPECSKTSSEKSSLTVCERSRTVEQPHEC
KQCGKTFTQSCHLVVHQRIHSGEKPYKCKQCGKTFRQRGNLQAHQRIHTGEKPFECLQCG
KSFRLKSILTDHQRIHTGEKPYKCKHCGKTFRQSCTLTDHQRIHTGEKSYECNHCGKAFR
NSSKLAQHKITHSGEKPFACNQCGKTFRSNSHLLKHQRIHTGEKPYACKQCGKKFTKRGN
LVVHERTHTGEKPYACNQCGKTFPRPDRLAQHQRIHTGEKPYECNQCGKTFRQYFSLTEH
KKIHTGEKPYACNKCGKTFRCNSVLIKHQRIHTGEKPYACKQCGRTFRHSNSLALHQKIH
TGEKPYECDDCDKAFNNHSALHKHQRIHTGEKPYKCDNCGKAFKHHSSVLVHQRIHTGEK
PYECEECGKTFTQSSKLALHQKIHTGEKTYE
Download sequence
Identical sequences H9H5X7
XP_016282455.1.35504 ENSMODP00000001972 ENSMODP00000001972

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]