SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002025 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002025
Domain Number 1 Region: 181-254
Classification Level Classification E-value
Superfamily Homeodomain-like 2.91e-26
Family Homeodomain 0.00055
Further Details:      
 
Domain Number 2 Region: 83-93,249-255
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0000131
Family Formin homology 2 domain (FH2 domain) 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002025
Domain Number - Region: 60-121
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0288
Family beta-sandwich domain of Sec23/24 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002025   Gene: ENSMODG00000001656   Transcript: ENSMODT00000002068
Sequence length 313
Comment pep:known_by_projection chromosome:BROADO5:8:307067782:307155460:1 gene:ENSMODG00000001656 transcript:ENSMODT00000002068 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEHPLFGCLRSPHGTAQGLHPFSQSSLALHGRSDHMSYPELSPSASSCIIAGYANEEGMF
ASQHHPRGHHHHHHHHHHHPQAPPPPPPPPPPPQHQALQGSWHLPPLASPPAAARHSLCL
QPDAGGGPELGGSAPGLCSSAGSLGASTPTGAACAPGDYGRQALSPGDAEKRAGKRKSDS
SDSQEGNYKSEVNSKPRKERTAFTKEQIRELEAEFAHHNYLTRLRRYEIAVNLDLTERQV
KVWFQNRRMKWKRVKGGQQGAAAREKELVNVKKGTLLPSELSGIGATGLQHTGDSLANDD
SHDSDHSSEHAHL
Download sequence
Identical sequences F6T730
ENSMODP00000002025 ENSMODP00000002025 XP_001363903.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]