SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002054 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002054
Domain Number 1 Region: 428-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.03e-26
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 176-233
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.4e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 372-429
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.02e-24
Family Classic zinc finger, C2H2 0.0052
Further Details:      
 
Domain Number 4 Region: 232-289
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.31e-24
Family Classic zinc finger, C2H2 0.0048
Further Details:      
 
Domain Number 5 Region: 289-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.69e-23
Family Classic zinc finger, C2H2 0.0032
Further Details:      
 
Domain Number 6 Region: 138-190
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.83e-21
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 7 Region: 470-522
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.51e-19
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Domain Number 8 Region: 744-793
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000775
Family Classic zinc finger, C2H2 0.027
Further Details:      
 
Domain Number 9 Region: 714-746
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000123
Family Classic zinc finger, C2H2 0.0078
Further Details:      
 
Domain Number 10 Region: 565-601
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000106
Family Classic zinc finger, C2H2 0.0069
Further Details:      
 
Domain Number 11 Region: 335-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000193
Family Classic zinc finger, C2H2 0.0089
Further Details:      
 
Domain Number 12 Region: 662-697
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000272
Family Classic zinc finger, C2H2 0.029
Further Details:      
 
Domain Number 13 Region: 827-858
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000019
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002054   Gene: ENSMODG00000001679   Transcript: ENSMODT00000002097
Sequence length 861
Comment pep:known_by_projection chromosome:BROADO5:6:85651351:85693302:-1 gene:ENSMODG00000001679 transcript:ENSMODT00000002097 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGPLNPTSALISRMEQGAELWGPDLQGPEESLRDGHKGARSENEEENLQPEGSGDEIPL
GDPPHSPELKDPPEMPLEEIPLDNPVSESVPTPSDWTKACEAGWQWGALTTWNSPPIVTA
SEPSLRELVQGRPSGGDKPYICNECGKSFSQWSKLLRHQRIHTGERPNTCSECGKSFTQS
SHLVQHQRTHTGEKPYKCPDCGKCFSWSSNLVQHQRTHTGEKPYKCTECEKAFTQSTNLI
KHQRSHTGEKPYKCGECRRAFYRSSDLIQHQATHTGEKPYKCTECGKRFGQNHNLLKHQK
IHAGEKPYRCTECGKSFIQSSELTQHQRTHTGEKPYECLECGKSFGHSSTLIKHQRTHLR
EDPFKCPVCGKTFTLSATLLRHQRTHTGERPYKCPECGKSFSVSSNLINHQRIHRGERPY
ICADCGKSFIMSSTLIRHQRIHTGEKPYKCPDCGKSFIRSSHLIQHRRTHTGEKPYKCPE
CGKSFSQSSNLITHVRTHMDENLFLCPECGKAFVDAAELLQHRLIHGGGKPPSGGALGDG
TEPASPAGEKSYKFSMGLGESALLPPPGAKPHKCLVCGKGFNDESIFMQHQRIHIGENPY
KTTDGTERPSPHPSQLRPQRTLLGRKSYSGAEKGDNSDHIGPTPKNLEGRESFGQNLELL
SPKSYICSHCGESFLDRSVLLQHQLTHGNEKPYIFPEFRTGVGEGAGPSPILSGKPFKCP
ECQKSFSLSSELLQHQKVHAGEKTYKSSSVLLEHLKSPLGARPYSCSVCGISFLDRLALI
RHQGSHTQEKPHTPGETLPEPASLPMSQDGEASPVIKSSSQCEAPKTQPGEKPYICPECG
EGFTETTTLLLHRGSHPGVTL
Download sequence
Identical sequences F6SQ37
XP_007498566.1.35504 XP_016279438.1.35504 XP_016279439.1.35504 ENSMODP00000002054 ENSMODP00000002054

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]