SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002087 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002087
Domain Number 1 Region: 289-345
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.14e-17
Family Classic zinc finger, C2H2 0.0085
Further Details:      
 
Domain Number 2 Region: 457-513
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-16
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 400-457
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000971
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 4 Region: 498-550
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000077
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 5 Region: 250-302
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000178
Family Classic zinc finger, C2H2 0.0062
Further Details:      
 
Domain Number 6 Region: 365-414
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000569
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002087   Gene: ENSMODG00000001702   Transcript: ENSMODT00000002130
Sequence length 743
Comment pep:known_by_projection chromosome:BROADO5:3:46378146:46496445:-1 gene:ENSMODG00000001702 transcript:ENSMODT00000002130 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQSDSRMIKDEDVCFSMSMKRAPAFPHCLQLGAPRMKSHQRQLFTEEFRGPFSQFRYEPP
SGDLDGFPGILEGGGSRKRKSMPTKMPYNLPPADATTSHQSDKGKSHGSPSLPLLFQQPP
PPKYDAQMIDLCNIGFQFYRTLEHLGAKPIKQEPIKPSAMWSHPPPPPFLSTPYPYYPKV
HPGLVFPFFMPPPGFPYSQHPFQPKRAAQPPMPPKAELQDGEEGKQKVERVDVNIQIDDS
YYVDVGGEQKRWQCPMCEKSYTSKYNLVTHILGHSGIKPHACSRCGKLFKQLSHLHTHML
THQGTRPHKCQVCHKAFTQTSHLKRHMMQHSDVKPYNCRICGRGFAYPSELKAHESKHES
GRENICVECGLDFPTLAQLKRHLTTHRGPIQYNCTECDKTFQYPSQLQNHMMKHQDIRPY
ICSECGMEFVQPHHLKQHSLTHKGVKEHKCGICGREFTLLANMKRHVLIHTNIRAYQCHL
CFKSFVQKQTLKAHMIVHSDVKPFKCKLCGKEFNRMHNLMGHMHLHSDSKPFKCLYCPSK
FTLKGNLTRHMKVKHGVMERGFHSPGFGRGRMALSQTVGVLRSLEQEEPFDLSQKTREKG
TPFHSDGESAKGSSCLEEEEEDNCFEPEPYSPGVYQQDKPLYPPQDLSRKTEEVMKSLQE
TYGDEKKGTLNEALEEKGKDSISVEGGQERDFACKDELRSFRAFQSGRLESSFSDYLYFK
HRNESLKELLERKMEKQAMLLGI
Download sequence
Identical sequences F6S6T7
ENSMODP00000002087 13616.ENSMODP00000002087 ENSMODP00000002087

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]