SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002114 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002114
Domain Number 1 Region: 1571-1662
Classification Level Classification E-value
Superfamily SET domain 4.97e-28
Family Histone lysine methyltransferases 0.0024
Further Details:      
 
Domain Number 2 Region: 58-165
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 0.000000000000105
Family Canonical RBD 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002114   Gene: ENSMODG00000001726   Transcript: ENSMODT00000002157
Sequence length 1670
Comment pep:known_by_projection chromosome:BROADO5:6:85832734:85903461:1 gene:ENSMODG00000001726 transcript:ENSMODT00000002157 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDQEGGGDGQKPPNFQWRNYKLIVDPALHRLPQKVYRYDGIHFSVNDAGYKIVSKLQDPR
QRLTWSKNRDLSLPVPKFKLDEFYIGQVPLKEVTFARLNDNVRETFLKDMCRKYGEVEEV
EILLHPRTRKHLGLARVLFASTRGAKETVKHLHHTPVMGNIIHAQLDIKGQQRMKYYELI
VNGSYTPQTVPTEGKALNEKFQGSGIPTETTESRRRPSSDSAYPSSTSVPVTPGNGTPCS
QDTTFSSSRQDTPSSYGQFTPQSSQGTPYTSRGSTPYSQDSAYSSRQGTPGYSSYHPDSS
SSTTSSSYKPRRSENSYQDSYSRRHFSSSATTVASSSSSSSSSSSSSSSSTSSSSSSSSS
SSSSSSSSSSSSSSSSSHYRSSDSHYPAYFESSSRYQRHASYPPRRAPREESPATPFPER
FPPSYTSYLPPEPSRPADQDYRPPAPEAAPPEPPEPGGGGGGGASPEQEEARSSPRPASP
IRSCSPAPEITNESVPFAQHSSLDSRIEMLLKEQRSKFSFLASDTEEEEDSNSLGPGARE
TGSEVPLGPTHGPCTPPPAPANFEDVVPMGNIDPGTTGESPTANGQDQASLHSSGEDMEI
SDDDGGGSPPTAPSPPQPPPPPPPPPPPPPFLAPLPLGYPHQPAYLLPPRPEAPPPPEYP
PPPPPPPHIYDFVNSLELMDRLGAQWGGMPMSFQMQTQMLTRLHQLRQGTGVTAASAAPP
SGGFGEHFLPFPPHQEAAYTLPYTLYTPGQESRGSYARETYHLPLQAEPLPSSSALGEEE
HPTPGEDVELTEGKVPPPAGTVGRVLATLVQEMKNIMQRDLNRKMVENVAFGAFDQWWES
KEEKAKPFQNAAKQQAKEEDKEKTKLKEPGLLSLVDWAKSGGATGLEGFGFGSGLRGALR
LPSFKVKRKEPSEISEGGEEKRPRPSTPAEEDDDEPDRDKEAGESSRPVMKGSKREEERS
KAQGKHRKPFALDSEGEEASQESSSDKDEEDEEEEEEEEEHSETMEASKKEAEASGGEDE
ESASSSKYSPYPESEGENDSTSDSESGSSSSSSSSSPSSSSSSSSSSASEEEEEEPPVVS
SALSPSRDIPSDLPVSVEEPEQEKTSVSPVMPISELEKAPVRPLGPPEEPLPETLQHPPE
PPAVPQASPPLPLASRPEECPSSPIPLLPPPKKRRKTVSFSASEETPTTPIPEVPPPVPP
PAKPLGPLSRKISRVGDRTIRNLPLDHASLVKSWPEDGSRMGRNRSGGRGRLPEEEEPGT
EVDLAVLADLALTPAPARRGLVALPVGDDSEATETSDEAERSGPTVPSVIHVLLEHNYAL
AVRPAPPTPVSRPLEPLPSPATVFSSPADEVLEAPEVVVAEVEEEEEGGEEEEEEEEEEE
ESSESSSSSSDGEGALRRRSLRSHARHRRQPLPPAPPPPPSYEPRSEFEQMTILYDIWNS
GLDAEDMGYLRLTYERLLQQDSGADWLNDTHWVHHTITNLTTPKRKRKPFDGPREHQTGS
ARSEGYYPISKKEKDKYLDVCPVSARQLEGSDTQGTNRVLSERRSEQRRLLSAIGTSAIV
DSDLLKLNQLKFRKKKLRFGRSRIHEWGLFAMEPIAADEMVIEYVGQNIRQVVADMREKR
YVQEGIGSSYLFRVDHDTIIDATKCGNLARFINHCCTPNCYAKEKKKHHS
Download sequence
Identical sequences F6XG79
ENSMODP00000002114 ENSMODP00000002114

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]