SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002168 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002168
Domain Number 1 Region: 543-600
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.74e-26
Family Classic zinc finger, C2H2 0.0027
Further Details:      
 
Domain Number 2 Region: 599-656
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.43e-25
Family Classic zinc finger, C2H2 0.005
Further Details:      
 
Domain Number 3 Region: 376-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.53e-25
Family Classic zinc finger, C2H2 0.0038
Further Details:      
 
Domain Number 4 Region: 487-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.59e-24
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 5 Region: 264-321
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.09e-24
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 6 Region: 181-238
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.37e-24
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 7 Region: 320-377
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.06e-23
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 8 Region: 436-488
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.61e-23
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 9 Region: 655-706
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.8e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 10 Region: 9-68
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 4.05e-20
Family KRAB domain (Kruppel-associated box) 0.0011
Further Details:      
 
Domain Number 11 Region: 144-195
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000112
Family Classic zinc finger, C2H2 0.0083
Further Details:      
 
Domain Number 12 Region: 229-258
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000222
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002168   Gene: ENSMODG00000022787   Transcript: ENSMODT00000002213
Sequence length 707
Comment pep:novel chromosome:BROADO5:Un:27291086:27333713:1 gene:ENSMODG00000022787 transcript:ENSMODT00000002213 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAFERDRLPGQEVVTFKDMAVDFTREEWRLLTPPQKELYKEVMLENARNLLSVGFAVPGD
VISYLEQREAPWLLEQEGLRSCSPGDISPEMKVTPIDTSLCVEESDRQRFMSDGPDKLHW
RELFVESQNSTLIECQMMHTEQKCNECNQCRKTFCQRSGLAIHQRIHIGEKLHKCKQCGK
TFRLRSSLAQHQRIHIGEKPYKCKQCGKTFRLRYSLAQHQRVHTGEKVYECKECGKIFCE
RYFTVHQRIHTGEKPYECTECGKAFCQRSGLANHQRSHTGEKPYECKECGKTFCQRSGLA
VHQRIHTGEKPYECKLCGKTFRLRPRLAGHQRIHTGEKPYKCKQCGKTFRLRSSLAQHQK
IHTGEKPYDCKQCGKTFRLRSSLGRHQRIHTGEKPYECKQCGKTFSRSYSLAQHQRIHTG
EKVYECKECGKIFHESYFAVHQRIHTGEKPYECTECGKAFCQRSGLANHQRSHTGEKPYE
CKQCGKTFSQRSGFAVHQRIHIGEKPYECYECGKTFCQKSGLANHQRIHTGEKPYECKEC
GKTFSHRSGFAVHQRIHTGEKPYECNECGKTFSRSSILAVHQRIHTGEKPYECKECGKTF
RQNSSLALHQTIHTGEKPYECKQCGKTFSLSSRLAIHLRIHTGEKPYECKECGKTFSQSS
SLALHQTIHTGEKPYECKQCGKTFRLRSSLAVHQRTHIGEKRYECEC
Download sequence
Identical sequences H9H5Y5
ENSMODP00000002168 ENSMODP00000002168

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]