SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002176 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002176
Domain Number 1 Region: 561-618
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.26e-26
Family Classic zinc finger, C2H2 0.0041
Further Details:      
 
Domain Number 2 Region: 421-478
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-24
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 255-312
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.93e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 4 Region: 200-256
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-24
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 5 Region: 315-367
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.55e-23
Family Classic zinc finger, C2H2 0.0031
Further Details:      
 
Domain Number 6 Region: 477-534
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-23
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 7 Region: 370-422
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.87e-23
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 8 Region: 603-655
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-22
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 9 Region: 61-106
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 5.89e-18
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 10 Region: 149-200
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000118
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 11 Region: 525-556
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000053
Family Classic zinc finger, C2H2 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002176   Gene: ENSMODG00000023630   Transcript: ENSMODT00000002221
Sequence length 666
Comment pep:novel chromosome:BROADO5:3:503071696:503087868:1 gene:ENSMODG00000023630 transcript:ENSMODT00000002221 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLFYPQLLSRPGNFVRSIPEASNQGREKMENEDSPGLLCCLSREPGFPGMAVERDRRTA
REVVTFQDVAVVFTREEWRLLSPPQKELYKEVMLENARNLLSVGEMRSEMTNPTEVSLPV
EELNLQRFMSYGPNNIAFREFCVSPKNLSHIEHQRMHTEEKSTGNNECGKTFMHRDSLAR
YKRIYTGEKYYECQQCGKIFSCSSTRAGHQRTHTGEKPYECKHCGKAFSRNSHLTVHQRI
HTGEKPYECKQCGKAFSCSSTRAVHQRIHTGEKPYACKQCGKAFSCSSTLAEHQRIHTGE
KPYECKQCGKLFSWNYLALHRRIHNGEKPYECKECGKAFSRSSTLVVHQRIHTGEKPYEC
KQCGKLFSWNYLALHQRIHNGEKPYECKECGKAFSRSSTLAVHQRIHTKEKPYECKECGK
AFRCSSTLAVHQRIHTGEKPFECKQCGKTFSRSSNLTVHQRIHTGENSYECKTCGKTFRR
SSNLTVHQRIHTGENSYECKTCGKTFSRSSNLTVHQRIHTGENSYDCKTCGKTFSRSSNL
TVHQRIHTEDNTCECKQCGKTFSQSSSLVEHERIHTGKKPYECKQCGKAFSRSSNLAVHQ
RIHTGEKPYSCKQCGKAFSRSSHLAEHQRIHTGEKPYSCKQCGKAFSRSSNLAVHQRNHT
GETSHE
Download sequence
Identical sequences F6WJ83
XP_007490277.1.35504 ENSMODP00000002176 ENSMODP00000002176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]