SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002177 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002177
Domain Number 1 Region: 104-162
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.49e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 2 Region: 156-213
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000879
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 3 Region: 476-525
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000016
Family Classic zinc finger, C2H2 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002177   Gene: ENSMODG00000001780   Transcript: ENSMODT00000002222
Sequence length 533
Comment pep:known_by_projection chromosome:BROADO5:Un:12234151:12243582:1 gene:ENSMODG00000001780 transcript:ENSMODT00000002222 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
IQSLFCESSGDSSLEKDFSGAPVGPSVSTPNSQHSSPICSLSGNSIKVEMYSDEESSRLL
GPDDRLLEKEDSVIVEDSLSEPLGYCDGSGPEPHSPGGIRLPNGKLKCDICGMVCIGPNV
LMVHKRSHTGERPFHCNQCGASFTQKGNLLRHIKLHSGEKPFKCPFCNYACRRRDALTGH
LRTHSVSSPTVGKPYKCNYCGRSYKQQSTLEEHKERCHNYLQSLSTEAQALTGPPGDDMR
DLEMVPDSMLLHSSSERPTFIDRLANSLTKRKRSTPQKFVGEKQMRFSLSDLPFDMNSGG
YEKDVELVAHPSLDPGFGSLAFVGTEHLRPLRLPPANCISELTPVISSVYTQMQPLPGRL
ELPGTREAGEGHEDLVDGGPLLYRARGPLADPGVSPSNGCQDSTDTESNHEERGGGIVTT
PQCPPNQPASALVVGSRPSPAYAKEDPKMQEGLPRSAPGSAKDMLRVVGEDGEPVKAFKC
EHCRILFLDHVMFTIHMGCHGFRDPFECNICGYHSQDRYEFSSHIVRGEHKVG
Download sequence
Identical sequences H9H5Y6
ENSMODP00000002177 ENSMODP00000002177 13616.ENSMODP00000002177

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]