SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002202 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000002202
Domain Number - Region: 147-152
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0915
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002202   Gene: ENSMODG00000001803   Transcript: ENSMODT00000002247
Sequence length 1209
Comment pep:known_by_projection chromosome:BROADO5:1:639632476:639694164:1 gene:ENSMODG00000001803 transcript:ENSMODT00000002247 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEDLDQSPLVSSSGSAASPARPQPEFKYQFVREPEDEEEEEEEEEEEDEDEDLEELEVLE
RKPAAGMAAVPLPVNAAAVAAAAAAAPLLDFETESVPPAPRGPLPAVPPAAPERQPRWEP
SPVSSSSPSPPPSAAASLEEDEPPSRPPPPPPTASVDPHPDPAPPAWTPSTPAPAAPPST
PAAPKRRGSSGSADETLFALPAASEPVMHSSAEKVMKEQPGNTISTCQEELTSVLLETAA
SLPSLSSLSAAPFKEPESFGNFPAIIPTKETLQTINEASKEFTEKAKNPFVDRDLREFSE
LKYSEMGSSFVGLQKAESTFVELPQEEILMKKQDEQENLVSEPLHQCQQELPLALTKSEE
KDKVVFSEKTKYGKDSIDEREDAPLREEYVDFKPFEQVWKVKDSYSEERNVEDVQGNLDN
KLESNVDEKYVADSLKKKNHDQDSESSNEDTSFPSTPEAMKDVSQAYISCASFEPDAVTE
TLTQKVFPLLEDQTSENKTDEKKIAEKQAQIVTENNSIKTTNPFLVSAQDLDRDYVSTDS
LSEVPVEVGASIPEGLTPDLVQEAYESKITDVTSTKLAYETKMDLVQTSESLQESIHSIS
QLCPSFEESEATPSPVLPDIVMEAPLNSVTPGTAASAVELSSSPLEAFTPVNYESLKLES
ENPPPYEDTMKMPSKEVPEIKEENKGPECISPVVEESEGSYISIACDLIKETKLSTESAS
PDFTDYSEIAVKENISQPMPDLSDLVEDSSPESEPVDLFSDDSIPEVPPKEDEAVLLERE
NLIETSLSSVIEHESKEKLNATPATMGKPYLESFQPIMDTSKTSSALSSEVTFMMVNKEK
IPLQMEELNTTVYSDEDLFVSKEPKIREAELFADSSPIQIIEDFSITVSSKTVPPAKLAK
EFTNVEVSPKGENGKLQEVVSTSLSSELPHDLSLKNVPTKIEEKIHGLHKATDGVSKDMP
ELSKGPSLPTNVSALLTNTETVRIVKPKVISKEAEGKKPSVTEKEKRSPSAIFSTELSKT
SVVDLLYWRDIKKTGVVFGASLFLLLSLTVFSIVSVTAYIALALLSVTISFRVYKGVIQA
IQKSDEGHPFRAYLDTEVAVSEALVQKYSNSALGHVNCTIKELRRLFLVDDLVDSLKFAV
LMWIFTYVGALFNGLTLLILALISLFSVPVIYERHQTQIDHYLGLVNKNVKDAMAKIQAK
IPGLKSKAE
Download sequence
Identical sequences F6T5Z0
ENSMODP00000002202 ENSMODP00000002202 13616.ENSMODP00000002202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]