SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002214 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002214
Domain Number 1 Region: 280-336
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.72e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 391-448
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.15e-25
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 3 Region: 168-224
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.97e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 4 Region: 223-280
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.62e-23
Family Classic zinc finger, C2H2 0.0035
Further Details:      
 
Domain Number 5 Region: 433-485
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.15e-19
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 6 Region: 129-181
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.58e-17
Family Classic zinc finger, C2H2 0.0059
Further Details:      
 
Domain Number 7 Region: 321-373
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000243
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002214   Gene: ENSMODG00000001814   Transcript: ENSMODT00000002259
Sequence length 509
Comment pep:known_by_projection chromosome:BROADO5:3:399844607:399850385:1 gene:ENSMODG00000001814 transcript:ENSMODT00000002259 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLYSRDVCAPGGETQSPGRCPPSKNKNSLETLIQKYPKDEEPKEIQSEWSKKDVSPNTE
HEDTKGIPLDWNKGVKFWSLEWKDTYEDNYRTETQWEKPTGKEQSKSSSWEWGPRKNITI
HQALPKRDKSHKCLECQKSFNNSSHLRIHQRTHTGEKPYKCSECEKCFGNSSHLIQHQRT
HTGEKPYQCNDCGKSFSNTSHLIIHERTHTGEKPYKCPECGKSFSSSSHLIQHHRSHTGE
KPYECPICGKCFSHSYVLIEHQRTHTGEKPYKCLDCGKRFSQSSSLIRHQRTHTGEKPYK
CLECGKSFGCNSTLIKHQRIHTGEKPYKCPECGKNFSRSSNLITHQKTHMGEKSYESVEF
GVNLNHNCNSVEHHRIQLREKPYKCCECGKSFNLSSHLIRHQRTHTGEKPYRCPECWKTF
SQSSTLVIHQRTHTGEKPYKCPDCGESFSQSFNLIRHQRTHKGDKPYKCTDCQKSFSRSA
YLSQHQKTHIREKLSTLPGVEENFTHEWT
Download sequence
Identical sequences F6T5Q5
ENSMODP00000002214 ENSMODP00000002214

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]