SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002351 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002351
Domain Number 1 Region: 79-333
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.29e-93
Family Protein kinases, catalytic subunit 0.0000086
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002351
Domain Number - Region: 53-68
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0942
Family beta-sandwich domain of Sec23/24 0.095
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002351   Gene: ENSMODG00000001926   Transcript: ENSMODT00000002400
Sequence length 683
Comment pep:known_by_projection chromosome:BROADO5:8:85659172:85741150:-1 gene:ENSMODG00000001926 transcript:ENSMODT00000002400 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEGAASPRPACPPPSPSCCGAALDPGSGAAAPAGLVPGASTRPAGAALELRKQQQQQQPQ
QQQQQHGVKRHHHKHNLKHRYELQETLGKGTYGKVKRATERFSGRVVAIKSIRKDKIKDE
QDMVHIRREIEIMSSLSHPHIISIYEVFENKDKIVIIMEYASKGELYDYISERRRLSERE
TRHFFRQIISAVHYCHKNGVVHRDLKLENILLDDNCNIKIADFGLSNLYQKDKFLQTFCG
SPLYASPEIVNGRPYRGPEVDSWALGVLLYTLVYGTMPFDGFDHKNLIRQISSGEYREPT
QPSDARGLIRWMLMVNPERRATIEDIANHWWVNWGYKSSVCDCDALRDSESPLLARIIDW
HHRSTGLQAEGETKVKCLAKPGASEGALERQRSLKKSKKENDIAQSGQDGPAESPSKSGS
KRPKGILKKRSNSEHRSHSAGFIEGVVSPTLPAAFKMEQELCRTGTPLKSPVEAEGAGTL
GPKQSATMPKKGILKKTQQRESGYYSSPERSESSELLDSNDAPGGSSLPSPGTSDSARGG
YRRKGILKHSSKYSASSTDSTLASPGGPALESMEERGGPGEGLSRSYSRPSSVISDDSIL
SSDSFDLLDLQENRPAQQRIRSCVSAENFLQIQDFEGLQNRPRPQYLKRYRNRMVDNSFS
LLTDMDDVTQVYKKALEICNKLN
Download sequence
Identical sequences F6W0T1
ENSMODP00000002351 XP_001374657.1.35504 ENSMODP00000002351

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]