SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002352 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002352
Domain Number 1 Region: 192-306
Classification Level Classification E-value
Superfamily POZ domain 6.28e-26
Family BTB/POZ domain 0.0015
Further Details:      
 
Domain Number 2 Region: 684-741
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000427
Family Classic zinc finger, C2H2 0.012
Further Details:      
 
Domain Number 3 Region: 877-929
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000355
Family Classic zinc finger, C2H2 0.016
Further Details:      
 
Domain Number 4 Region: 647-698
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000841
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 5 Region: 762-813
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000138
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 6 Region: 565-615
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000141
Family Classic zinc finger, C2H2 0.05
Further Details:      
 
Domain Number 7 Region: 818-877
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000126
Family Classic zinc finger, C2H2 0.02
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002352   Gene: ENSMODG00000001927   Transcript: ENSMODT00000002401
Sequence length 1050
Comment pep:known_by_projection chromosome:BROADO5:4:62354345:62384638:1 gene:ENSMODG00000001927 transcript:ENSMODT00000002401 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSEESYRAILRYLTNEREPYAPGTEGNAKRKIRKAAACYVVRGGTLYYQRRQRHRQRFA
ELEVVLQPERRRGLIEAAHLGPDGTHHTRHQTWHDLSKNYWWRGILKQVKDYIKECSKCQ
EKLDRARPISDTSEMLEELGLELESTEESNETDDDQSNPASVPNAVPKTVKKKPISKHEL
VFVDTKGVMKQSSPKHCRAVLKQLNQQRLNNQFCDVTLLIEGEEYRAHKSVLSANSEYFR
DLFIEKGAVSSHEAVVDLSGFCKSSFLPLLEFAYTSVLSFDFCSMADIAILARHLFMSEV
LEICESVHKLMEEKQITVYKKGEVQTVESTQNLPDQNESTAQTVGNIEEVVPPELETSAF
VAPVNGEFPGAGQEGETTPQVEPQVCSASQSVLVQTENITHSQSTLKNETVTNSNMIILE
IETKKDDKVSSALSTPSVVEDGNMSTPADKEMENNESNKSFEDACAEDITEEQKQKRSRP
TQVQGSPVIQTEKAALSPDDTYKSRLRQRSVSEGGYIRLHKGIEKKLQNRKANPKSAVQQ
VALKLVQRGKKMKQPKRETNENTEEETVHRCSECGMDFQRRYALIMHTLKHERTKDYKCP
LCKKEFQYSASLRAHLIRHTRKSDVPTSSTAEEESGTSTEKGRTKREFICSICGRTLPKL
YSLRIHMLKHTGVKPHACQVCGKAFIYKHGLKLHLALHEAQKQFQCELCVKSFVTKRSLQ
EHMSIHTGESKYLCSICGKSFHRGSGLSKHLKKHQPKPEVRGYRCTQCEKSFFEARDLRQ
HMNKHLGVKPFQCQFCEKCYSWKKDWYSHVKSHSVTEPYRCNVCGKEFYEKALYRRHVKK
ATHGKKGRAKQNLERVCEQCGRKFTQLREYRRHMNNHEGVKPFECLTCGVAWADARSLKR
HVRTHTGERPYVCPVCNEAYIDARTLRKHMTKFHRDYVPCKIMLEKDTLQFHNQGTQVEH
AFSILTSGMQEQESSDPQEIETVVVTGETIEAIEAVAATEECASVSTLSDQSIMQVVNYV
LAQQQGQKISEVTEAIETVEVEVAHVSEPE
Download sequence
Identical sequences F6W0S3
ENSMODP00000002352 ENSMODP00000002352 XP_001370274.1.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]