SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002389 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002389
Domain Number 1 Region: 215-272
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.42e-26
Family Classic zinc finger, C2H2 0.0029
Further Details:      
 
Domain Number 2 Region: 327-384
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.88e-26
Family Classic zinc finger, C2H2 0.0036
Further Details:      
 
Domain Number 3 Region: 131-188
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.8e-26
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 4 Region: 271-328
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.05e-25
Family Classic zinc finger, C2H2 0.0056
Further Details:      
 
Domain Number 5 Region: 440-495
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.72e-23
Family Classic zinc finger, C2H2 0.0055
Further Details:      
 
Domain Number 6 Region: 388-441
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.8e-23
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 7 Region: 78-132
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.4e-20
Family Classic zinc finger, C2H2 0.0094
Further Details:      
 
Domain Number 8 Region: 2-42
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 9.29e-16
Family KRAB domain (Kruppel-associated box) 0.0016
Further Details:      
 
Domain Number 9 Region: 178-210
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000669
Family Classic zinc finger, C2H2 0.011
Further Details:      
 
Domain Number 10 Region: 488-510
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000133
Family Classic zinc finger, C2H2 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002389   Gene: ENSMODG00000022822   Transcript: ENSMODT00000002439
Sequence length 513
Comment pep:novel chromosome:BROADO5:Un:16085009:16150909:1 gene:ENSMODG00000022822 transcript:ENSMODT00000002439 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
EVVTFQDVAVDFTRGEWRLLSPPQKELYKEVMLENAWNLLSVVPSMDTSLSVEESDQQKF
MRDGPDKLCWREFFDESQNSSLIEHQRMHTEQKSSECNQCGKTFMHRASLAGHQRIHTGE
KPYECKQCGKTFRLSSSLAGHQRIHTGEKPYECNQCGKTFRLSSSLAGHQRIHTGEKPYK
CKQCGKTFRLTSSLVGHQRIHTGEKPYKCKQCGKTFKTSSSLGRHQRIHTGEKPYECKQC
GKTFSRSYSLAQHQRIHTGEKPYECKECGKAFYESSYLAVHQRIHTGEKLYECNECGKTF
CQRSGLAVHQRIHTGEKPYECNQCGKAFRLSPRLAVHQRIHTGEKPYECNQCGKTFSRSY
SLAVHQRIHTGEKPYECNHCGKAFREKYSSLAVHQRIHTGEKPYECKQCGKTFRVRSSLA
QHHRIHTGEKPYECKKCGKSFRLRSKLAQHHRIHTGEKPYECKQCGKTLRVRSSLARHQR
IHTGEKPYECKQCGKSFSQSSRLTGHQRNHRLS
Download sequence
Identical sequences H9H5Z0
ENSMODP00000002389 ENSMODP00000002389

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]