SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002398 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002398
Domain Number 1 Region: 149-273
Classification Level Classification E-value
Superfamily Acid proteases 1.69e-35
Family Retroviral protease (retropepsin) 0.00011
Further Details:      
 
Domain Number 2 Region: 27-156
Classification Level Classification E-value
Superfamily dUTPase-like 3.79e-22
Family dUTPase-like 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002398   Gene: ENSMODG00000001967   Transcript: ENSMODT00000002448
Sequence length 294
Comment pep:novel chromosome:BROADO5:3:99656329:99657230:-1 gene:ENSMODG00000001967 transcript:ENSMODT00000002448 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
FDGQILPPVQGNRMGGLFWEPLSSSLTRATTGSAGLDLCSSTTRILTPEEGPIVLPTGKF
GPPPPGMFFLVIDRALTTLQGVVVHPTLVDNDYTGEIKIIIESPHGPVTIPAGRRLAQAF
PLPMIGKFPAVAHTRGPSSPGSSNIYWVQQLTESRLTLQLKIEGKTFTGLLDTGADSTVI
SQTHWPHSWPLQPSSTHLSGIRQSSKVLNWQDTEGNIGTTRPYVVAGLPVNLWGRDILAQ
MRLLMVSPSDSVTTMILKSGYLPGKGLGKREQGLHPISFQPHKDREGLGLQSFS
Download sequence
Identical sequences F6V257
ENSMODP00000002398 13616.ENSMODP00000002398 ENSMODP00000002398

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]