SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002407 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002407
Domain Number 1 Region: 489-545
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 9.89e-22
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 2 Region: 377-433
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.28e-18
Family Classic zinc finger, C2H2 0.014
Further Details:      
 
Domain Number 3 Region: 530-582
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 5.64e-18
Family Classic zinc finger, C2H2 0.0049
Further Details:      
 
Domain Number 4 Region: 133-191
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.27e-17
Family KRAB domain (Kruppel-associated box) 0.002
Further Details:      
 
Domain Number 5 Region: 433-489
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.89e-17
Family Classic zinc finger, C2H2 0.01
Further Details:      
 
Domain Number 6 Region: 339-390
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000212
Family Classic zinc finger, C2H2 0.0057
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002407
Domain Number - Region: 44-116
Classification Level Classification E-value
Superfamily Tropomyosin 0.00157
Family Tropomyosin 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002407   Gene: ENSMODG00000001974   Transcript: ENSMODT00000002457
Sequence length 639
Comment pep:known_by_projection chromosome:BROADO5:8:213435850:213466451:1 gene:ENSMODG00000001974 transcript:ENSMODT00000002457 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAPAPIPEWESDCTTSLQSLPLPSEAHLQTAAISLWTVVAAVQAVERKVEVHSRRLL
HLEGRTGAAENKLTNCEKTVADLGNQLEGKWAVLGTLLQEYGLLQRRLENMENLLRNRNF
WILRLPPGIKGDIPKVPVTFDDVSIYFSTPEWEKLEEWQKELYKNIMKGNYESLISMDYA
MTQPEVLSQTQPEVEHNTENQVRPDGSEMTAEPSDEPGISTSDILSWIKQEEEPQVEGPQ
ATEESDIYKGTYADDELAIKAESLTGGQLCSDAQVTSSNAPGVTKDAFQDAAFKSQHPLP
VLPSGPSVNNPLEPLGGQASFTQLGNLNLTTPSGEQQQYFPCRHCGKNFNEKEMLQDHQS
SHAGERPFACAQCPKRFAQQANLSNHARVHTTERAHTCPHCSKSFVHPSRLTYHLRVHSG
ERPFPCPECPKRFADQSRLTSHRRGHSGERPFRCAQCGRSFSLKISLLLHQRGHAQERPF
SCPQCGIDFNGHSALIRHQMIHTGERPYQCGDCGKSFMRKEHLLNHQRLHTGERPFHCAH
CGKSFIRKHHLMKHQRIHTGERPYPCPCCGKSFRYKQTLKDHLRAGHDGSCSGDGDVPGQ
PPDPPGLLLPGLEPTGLGIGADGLEANHWYGEGGGGGVL
Download sequence
Identical sequences F6RIN5
ENSMODP00000002407 ENSMODP00000002407 XP_001368783.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]