SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002422 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002422
Domain Number 1 Region: 530-587
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.12e-20
Family Classic zinc finger, C2H2 0.008
Further Details:      
 
Domain Number 2 Region: 572-624
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.64e-20
Family Classic zinc finger, C2H2 0.006
Further Details:      
 
Domain Number 3 Region: 195-253
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 1.83e-16
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 4 Region: 492-544
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000393
Family Classic zinc finger, C2H2 0.015
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002422
Domain Number - Region: 95-175
Classification Level Classification E-value
Superfamily Tropomyosin 0.0203
Family Tropomyosin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002422   Gene: ENSMODG00000001987   Transcript: ENSMODT00000002473
Sequence length 644
Comment pep:known_by_projection chromosome:BROADO5:8:213477818:213500295:1 gene:ENSMODG00000001987 transcript:ENSMODT00000002473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQFVSTRPQPQQLAIQGLGLDSASWSWAQALPPDEVCPQEPGAPRAGEMAEGIPPMQAQE
WDMDTRRPMPFQFPTFPERAPVYPDRMMREPQLPTAEISLWTVVAAIQAVERKVDAQASQ
LLNLEGRTGTAEKKLADCEKTAVEFGNHMESKWAMLGTLLQEYGLLQRRLENMENLLRNR
NFWVLRLPPGSKGEVPKVPVTFVDIAVYFSEDEWKNLDEWQKELYNNLVKENYKTLMSLG
AENTVPKPDAQSRVEPREEPCVWEQHNPEEREIPMDPSTAIEALIQAPAASSQVKREEPL
CARVQRCSEEREIVADTVTDSPISTQDILSRIKQEEQHCVWDQQDLEERDIPTDPNSESL
ISAHDILSWIKQEEEPYPWGPPDSVERDMAIDTNAGDGLLMVKSSSLPVPQHQPHQQSIP
PLPGPENAGGGPSRGVVGMLDDLFPMVPRERGLCDGLHSPPGSPAVESGGGEGSSLAAEH
QRSHFLSPGQDKSHFCLQCGKTFDVRKSLVIHHRSHTKDRPFECAECAKSFNCHSGLIRH
QMTHRGERPYKCSECEKTYSRKEHLQNHQRLHTGERPFHCALCGKSFIRKQNLLKHQRIH
TGERPYQCSECGKSFRYKESLKDHLRVHSASLGTSRPHQALERD
Download sequence
Identical sequences F6RIC0
13616.ENSMODP00000002422 ENSMODP00000002422 XP_007504596.1.35504 ENSMODP00000002422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]