SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002429 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002429
Domain Number 1 Region: 443-492
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.88e-18
Family Classic zinc finger, C2H2 0.0026
Further Details:      
 
Domain Number 2 Region: 137-195
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-17
Family KRAB domain (Kruppel-associated box) 0.0031
Further Details:      
 
Domain Number 3 Region: 331-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000392
Family Classic zinc finger, C2H2 0.026
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002429
Domain Number - Region: 37-117
Classification Level Classification E-value
Superfamily Tropomyosin 0.00049
Family Tropomyosin 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002429   Gene: ENSMODG00000001991   Transcript: ENSMODT00000002480
Sequence length 510
Comment pep:known_by_projection chromosome:BROADO5:8:213523365:213544808:1 gene:ENSMODG00000001991 transcript:ENSMODT00000002480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAVPPPNKGKRRSTPINSSSLLPSASEKDSYLQTTEISLWTVVAAIQAVEKKVDSQAA
RLQTLEGRTGTAEKKLADYEKTAVEFGNQLEGKWAVLGTLVQEYGLLQRRLENMENLLRN
RNFWILRLPPGSKGEVPKVPGTFENDGVYFSEQEWENLDDWQKELYRNVMKSNFETLVSL
DCAISNPEILAHQEEESGTEELGDLAGVSPGGPHLADGVMIKQEMKYHQESPEDLPGEFS
GSIEQHTLLIPEQAATWDGQGNSILLETDPEMAKLENPIECDQDRNDAKTLGYHRKRKSS
GQARSGQECRQGMRLKRSLAHPRSPPATGSYECSECDISFRYKQQLAVHMRTHPGWGSFG
DPEPEETLRPRPQLKPQAKKVKPHRCEECLRSFSCKASLVTHQRFHLQEGSSAGQRVQER
FSPNSLVALPGHIPWRKSRSSLICGYCGKSFSHPSDLVRHQRIHTGERPYSCAQCEKSFV
QKQHLLQHQKIHQRERGGLALEPGGNDGLL
Download sequence
Identical sequences F6RI72
XP_007504597.1.35504 ENSMODP00000002429 ENSMODP00000002429

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]