SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002481 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002481
Domain Number 1 Region: 97-152
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.19e-20
Family Classic zinc finger, C2H2 0.000069
Further Details:      
 
Domain Number 2 Region: 664-730
Classification Level Classification E-value
Superfamily Homeodomain-like 3.85e-16
Family Homeodomain 0.001
Further Details:      
 
Domain Number 3 Region: 60-95
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000155
Family Classic zinc finger, C2H2 0.00034
Further Details:      
 
Domain Number 4 Region: 467-531
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000000000684
Family Homeodomain 0.004
Further Details:      
 
Domain Number 5 Region: 568-630
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000133
Family Homeodomain 0.0000888
Further Details:      
 
Domain Number 6 Region: 299-351
Classification Level Classification E-value
Superfamily Homeodomain-like 0.0000000012
Family Homeodomain 0.012
Further Details:      
 
Domain Number 7 Region: 783-827
Classification Level Classification E-value
Superfamily Homeodomain-like 0.000000263
Family Homeodomain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002481   Gene: ENSMODG00000002035   Transcript: ENSMODT00000002533
Sequence length 875
Comment pep:known_by_projection chromosome:BROADO5:3:397646734:397649481:-1 gene:ENSMODG00000002035 transcript:ENSMODT00000002533 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASKRKSTTPCMVLASEQDPDLELISDLDEGPPVLTPIENAAAESISSDEDVQELVDSDN
QQNKKVEGGYECKYCTFQTPDLNMFTFHVDSEHPNVVLNSSYVCVECNFLTKRYDALSEH
NLKYHPGEENFKLTMVKRNNQTIFEQTINDLTFDGSFVKEENSDQIESIETPSSGISISK
TPIMKMMKNKVENKRIAVFHNSEDIPEEKENETKSGHEEVVKNPTSSASESNTSTSVVNS
IHPNTTNTVVTPATVLQPGLAQVITAAVSAQQNSNLIPKVLIPLNSIPTYNAALDNNPLL
LNTYNKFPYPTMSEITVLSAQAKYTEEQIKIWFSAQRLKHGVSWTPEEVEEARRKQFNGT
VHTVPQTITVIPTHISAASNGLPSILQTCQIVGQPGLVLTQVAGTNQLPVTTPIALTVAG
VPNQTHMQKSQVHSAQPTAETKPAPTPAPASQLIKHETALVNPDSFGIRAKKTKEQLAEL
KVSYLKNQFPHDSEVIRLMKITGLTKGEIKKWFSDTRYNQRNSKSNQCIHLNSEACTPIV
IDSSDETAESPTIVTPQPKQPGNSFPDFTPQKFKEKTSEQLRVLQASFLTNPILTDEELN
RLRAQTKLTRREIDVWFTERKKSKTSKEEKTEIDESNAGSSKEEPGEASPQEESGASKLV
TTTNKVCKKSPEQLHILKSAFVRTQWPSPEEYDKLAEESGLARTDIVSWFGDTRYAWKNG
NLKWYYYYQSASSNSMNGQASFRRRGRGRPKGRGRGRPRGRPRGSKRLNNWDRIPSLIKF
KTGTAILKDYYMKHKFLNEQDLDELVAKSHMGYEQVREWFAERQRRSELGIELFEENEDD
DEIIDDQEEDDEETDDSDTWEPPRHVKRKLSKSDD
Download sequence
Identical sequences F6QW83
ENSMODP00000002481 ENSMODP00000002481 13616.ENSMODP00000002481

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]