SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002494 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002494
Domain Number 1 Region: 312-369
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.39e-25
Family Classic zinc finger, C2H2 0.0051
Further Details:      
 
Domain Number 2 Region: 256-313
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.18e-25
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 3 Region: 172-229
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.59e-23
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 4 Region: 2-59
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.4e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 5 Region: 354-406
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1e-20
Family Classic zinc finger, C2H2 0.0054
Further Details:      
 
Domain Number 6 Region: 137-186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000000335
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 7 Region: 219-251
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000000114
Family Classic zinc finger, C2H2 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002494   Gene: ENSMODG00000029094   Transcript: ENSMODT00000002546
Sequence length 414
Comment pep:novel chromosome:BROADO5:7:64019649:64034208:-1 gene:ENSMODG00000029094 transcript:ENSMODT00000002546 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEAVTFKDVAVDFTREEWRLLAPPQKELYKEVMLENVWNLLSVGLPAPPEDMISSLEQRE
APWMLEQEGLRTCCLEGEIRPDMKVTPTEVSFSVEETEKQKFMSDGPDNLTWREFCVQSQ
NSSVPEHQKMNSEESRECNQYAKTFKHRASLAGYQRIHTGKKPYECKQCGETFSQKFQLA
GHQRIHSGEKPYKCKQCGKTFRENSHLAQHQRIHSGAKPYECKQCGKTFSQISSFAVHQR
VHTGEKPFECNQCRKTFICSSNLAVHQRVHTGEKPFECKQCRKTFSQSSNLAQHQRIHTG
EKSYECKQCGKTFRLRFDLVKHQRIHTEEKPYECKQCGKTFSQSSNLAVHQRVHTGEKPY
ECNQCQKTFSCSSNLTVHQRVHTGEKPYECKQCGKTFSQKFSLAGHQRIHISEV
Download sequence
Identical sequences F6QC52
ENSMODP00000002494 ENSMODP00000002494

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]