SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002500 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002500
Domain Number 1 Region: 259-316
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.42e-26
Family Classic zinc finger, C2H2 0.0042
Further Details:      
 
Domain Number 2 Region: 203-260
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 2.52e-26
Family Classic zinc finger, C2H2 0.0047
Further Details:      
 
Domain Number 3 Region: 147-204
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 6.66e-26
Family Classic zinc finger, C2H2 0.0044
Further Details:      
 
Domain Number 4 Region: 301-353
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3e-22
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 5 Region: 105-157
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.21e-21
Family Classic zinc finger, C2H2 0.0066
Further Details:      
 
Domain Number 6 Region: 2-57
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 2.88e-21
Family KRAB domain (Kruppel-associated box) 0.0012
Further Details:      
 
Domain Number 7 Region: 78-115
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000842
Family Classic zinc finger, C2H2 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002500   Gene: ENSMODG00000002051   Transcript: ENSMODT00000002552
Sequence length 361
Comment pep:novel chromosome:BROADO5:7:64289206:64298637:-1 gene:ENSMODG00000002051 transcript:ENSMODT00000002552 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVTFKDVAVDFTREEWHLLAPPQKELYKEVMLENAWNLLSVGLAVSREDVISYFEQREAP
WMLEQVDLRNCCPGEIHTGKKPYECNQCGKTFRDSSNFAVHFRVHTGEKPYECNQCGKIF
SCSSSLAVHQRIHTREKPYECKQCGKTFSQRSSLALHQRVHTGEKPYECKQCGKAFSQTS
KLALHRRIHTGEKPYECNQCGKTFRDSSNFTVHLRVHTGEKPYECNQCGKTFSCSSSLAV
HQRIHTGEKPYECNQCGKTFNCSSSLAVHQRIHTGEKPYECKQCGKTFIQSSRLAVHQRI
HTGEKPYECNQCGKTFNQSSGLAVHQRIHTGEKPYECNQCGKTFHQRSRLAVHQRIHTGE
K
Download sequence
Identical sequences F6V0B0
ENSMODP00000002500 13616.ENSMODP00000002500 ENSMODP00000002500

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]