SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002508 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMODP00000002508
Domain Number - Region: 8-18
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.0146
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002508   Gene: ENSMODG00000002059   Transcript: ENSMODT00000002560
Sequence length 125
Comment pep:known_by_projection chromosome:BROADO5:5:116451751:116457950:1 gene:ENSMODG00000002059 transcript:ENSMODT00000002560 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEARASPPPPPPPPSSPSSPMARAAAFSSSPELPAILAGRIRNQSRSQALEPPPVDPLE
EVEMQIDDAAFSLIKLLEATSAVSAQVEELAFKCTENARFLKTWRGLLKEGYDSLKLDSQ
CSTTN
Download sequence
Identical sequences F6V067
ENSMODP00000002508 ENSMODP00000002508 XP_001374974.2.35504

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]