SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002541 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002541
Domain Number 1 Region: 84-390
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.12e-63
Family Protein kinases, catalytic subunit 0.000000000167
Further Details:      
 
Domain Number 2 Region: 17-72
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.000000034
Family beta-sandwich domain of Sec23/24 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002541   Gene: ENSMODG00000002087   Transcript: ENSMODT00000002593
Sequence length 422
Comment pep:known_by_projection chromosome:BROADO5:2:113014569:113079663:1 gene:ENSMODG00000002087 transcript:ENSMODT00000002593 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLSNSPGQTPPVLFPNPPPPPPPQQPQPPSQSQPQPQAPVLPLPPPPPPPPPPQQQSQPP
PPPQPPQQFPQFYVKSSLQIKKNAITDDYKVTSQVLGLGINGKVLQIFNKKTGEKFALKM
LQDCPKARREVDLHWRASQCPHIVKIVDVYENLYAGRKCLLIIMECMDGGELFSRIQDRG
DQAFTEREASDIMKSIGEAIQYLHSINIAHRDVKVVSTFPSICLLPQVGDYGIMLARVGR
TYLSPSNLFSFTAPEVLGPEKYDKSCDMWSLGVIMYILLCGYPPFYSNHGLAISPGMKTR
IRMGQYEFPNPEWSEVSEEVKMLIRNLLKTEPTQRMTITEFMNHPWIMQSMQVPQTPLHT
SRVLKEDKERWEDVKEEMTSALATMRVDYEQIKIKKIEDATNPLLLKRRKKARALEAAAL
AH
Download sequence
Identical sequences F6UZ64
ENSMODP00000002541 ENSMODP00000002541

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]