SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002723 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002723
Domain Number 1 Region: 100-227
Classification Level Classification E-value
Superfamily Second domain of FERM 9.94e-32
Family Second domain of FERM 0.0017
Further Details:      
 
Domain Number 2 Region: 231-331
Classification Level Classification E-value
Superfamily PH domain-like 6.88e-25
Family Third domain of FERM 0.003
Further Details:      
 
Domain Number 3 Region: 11-62
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000351
Family Ras-binding domain, RBD 0.054
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002723
Domain Number - Region: 886-926
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.0471
Family beta-sandwich domain of Sec23/24 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002723   Gene: ENSMODG00000002236   Transcript: ENSMODT00000002778
Sequence length 1512
Comment pep:known_by_projection chromosome:BROADO5:X:11782318:11827928:-1 gene:ENSMODG00000002236 transcript:ENSMODT00000002778 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKKEALLLIPNVLKVFLENGQIKSFTFDGRTTVKDVMVTLQDRLSLRYIEHFALVLEYA
SPEQSHKFLLLQDKQPLAHVVQRTHYQGMRCLFRVSFFPKDPVELLRQDPAAFEYLYIQS
RNDVIRERFGMDPKPEMLLGLAALHIFITVSAARPSQKFSLKNVEKEWGLEPFLPPSLLQ
SIKEKNLRKSLSQQLKAHQAHPPSGTKGSQMQAKLQYLRILNELPTFTGVLFNTVGLDEK
HSATTLLVGPRHGISHVIDLKTNLTTVLSEFSKISKIQLFQENQGVARVETSILDAKPLV
LLMEWPEATNFACLIAGYCRLLLDSRKMMFSKTPSQAPSLPMNKADYMQNAHHPVSGGHL
GKKESSFVGSMVSSPGKPCSQGPPTANSELVSFCYLHMREQRKERESQTDINENLIFFEE
TRPRTKSDPTSKSSGQGYSEAANDYDTTRPVQVPCTSRARAYTIDNTLGAEALNFYCDSC
KAKLKNQLGSRKNRRPGTSCDNMVDLMSLPPPGSEEEEEEEDESTALLPAIAAPPPGFRD
NSSDEDDPKRRVAQSQEQGRPLCGILYDEIPVTLIDSVQTRTVRDHAQELDDALVSTLQA
LEALAAAEDCPHPPPPQTAGLIVLATITPESSLDSGHETNSSELTDMSEMVSAMKQRQNA
TYFLAQHINKEGLLARKDLPFRIPSCATQAVLTAPYPLGRQEAGPAVAAAAAAAAARKVA
LPGQGPGPVGNRRRLDPAEVQTHRELPPALAVHPALASKLSSEPRSQGLVPWGAEGKDPE
HPKAALEMSLRATPSALSGEQGAELREKVPKEVRLSPKLILDSKGSVTPAILSAALQQAV
HNKALASPGAALDSTPRGERKQGPSTGSSSSSICKSLKTKGSPSPAEVTLSYQQQQQQQQ
QQQQQQQQQQRGRGQFSPEASPRAKAPSRIQADPLRLSLIEEDKLSAQGFPAKSYLPRKV
REPLGKQVSGEVGSRGGSEGASSASRKQGFAMSQGERGQMESSRLEDSGRGPRAGHPSTF
QSSGGQPRGPSSLGLWAGGRQANTMPSRKPAKALDGAHSDTDGPAKPKASKAPFRLRNLF
SATFPSLMKKETDERQAQLQKVKQYELEFLEELLKPQSKGDLPAPEYLHPSGPGRCSCQL
RSSPVQQVPGISREQRRSCDCKRICRGGRPQAAQLPAPELLRGRERNQGLPLPKRPEALS
ALSFSSPTESCRVRSTSLESRECRSEPESEEVYPGPADLEEDGEGDKCCSIRYCFYYRKC
DMADDGSDGKDELSYSIPMQFLPGMKLDDQVVPVVSHTLQVLDATTCSSSSPEDNQTQEI
DLRISTFEGSLAKINALQGHIYALPDGFLAVQLDTNELLAVLRQCVVNPEVRGPKPHTSQ
LSQYKQELALKFKELRASCRRVAAVDKSPTHMLAAITGSFQVLSGLIETFVRLVYIVRSE
AQRQELLVKVEEVVKNYTFLLRAAEESTARTLNQQQMAAAAALGATGPALERPPSATVMS
TFTRSLKTLINK
Download sequence
Identical sequences F7DFS5
ENSMODP00000002723 XP_007507060.1.35504 ENSMODP00000002723

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]