SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002819 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002819
Domain Number 1 Region: 471-527
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 8.1e-22
Family Classic zinc finger, C2H2 0.0064
Further Details:      
 
Domain Number 2 Region: 414-471
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.73e-21
Family Classic zinc finger, C2H2 0.0046
Further Details:      
 
Domain Number 3 Region: 136-197
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 6.15e-21
Family KRAB domain (Kruppel-associated box) 0.0022
Further Details:      
 
Domain Number 4 Region: 376-428
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.58e-17
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 5 Region: 527-581
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.26e-16
Family Classic zinc finger, C2H2 0.0068
Further Details:      
 
Domain Number 6 Region: 345-389
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000619
Family Classic zinc finger, C2H2 0.0076
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002819
Domain Number - Region: 30-116
Classification Level Classification E-value
Superfamily Tropomyosin 0.000817
Family Tropomyosin 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002819   Gene: ENSMODG00000002313   Transcript: ENSMODT00000002875
Sequence length 656
Comment pep:novel chromosome:BROADO5:8:213561172:213589653:1 gene:ENSMODG00000002313 transcript:ENSMODT00000002875 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEAAPAPSQEWDTSMQHPVPPASPTVPHREAQLQSAEISLLAILASIQAVEQKVESQAA
RLQTLEGRTGTAEKKLIDCEKTTMEFGNQLEGKWAVLGTLLQEYGLLQRRLENMENLLRN
RNFWILRLPPGSKGEVPKVPVIIEDVAVYFSEQEWGNLDEWQKELYKHVMRGNYETLVSL
DYAISKPDLLSRIEQGEEPCGQELSNTEERENPVHPSTETSALASSQDVLPWIKQEGGCG
RNQQNLQESEISTDLCTAEDWLVSKEKEKSQEKGSKDLEPSWVLQGRDKESLHQTPELAL
GGGSCENPCSSSLLRGPPGKSAPWERDFSALSPGPYCQDVPASVSAERPYPCAECGQSFS
RKEHRTQHQQALHSPRPFACPQCPKSFAQQATLTSHYRIHTGERAYTCAQCGKSFIHQST
LTTHYRTHTGEKPYPCAECEKRFSRLSTLLEHRRTHTGEKPYQCTECERRFSRLSTLVEH
RRTHTGEKPYQCAECEKRFTRLANLTVHQNTHSGERTYKCAQCGKRFAQKPSFLRHLRSH
TQEKLYPCGQCGKSFICRSWLVRHQGSHVGELPRPCTECERGCPPPKEPPAGPLGSGGQE
RLHAPESLLGKHDEGARTGQDPKGRRGAKEQGGGAQGGLGEPLHNPHSYVKMENVG
Download sequence
Identical sequences F6YDL9
XP_007504599.1.35504 ENSMODP00000002819 ENSMODP00000002819

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]