SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002840 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002840
Domain Number 1 Region: 290-351
Classification Level Classification E-value
Superfamily KRAB domain (Kruppel-associated box) 3.01e-21
Family KRAB domain (Kruppel-associated box) 0.0017
Further Details:      
 
Domain Number 2 Region: 744-801
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 4.93e-20
Family Classic zinc finger, C2H2 0.0043
Further Details:      
 
Domain Number 3 Region: 686-745
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 1.47e-18
Family Classic zinc finger, C2H2 0.0098
Further Details:      
 
Domain Number 4 Region: 648-700
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 3.87e-18
Family Classic zinc finger, C2H2 0.0039
Further Details:      
 
Domain Number 5 Region: 790-842
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 7.88e-16
Family Classic zinc finger, C2H2 0.0053
Further Details:      
 
Domain Number 6 Region: 557-609
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000000341
Family Classic zinc finger, C2H2 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002840   Gene: ENSMODG00000002329   Transcript: ENSMODT00000002896
Sequence length 845
Comment pep:known_by_projection chromosome:BROADO5:8:213888317:213920053:-1 gene:ENSMODG00000002329 transcript:ENSMODT00000002896 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEASPAPVQELDMETRRPSPLAFSSVPQRETLPHSPAGPLRETPSQYSTLSPKETPSLF
PAIPQKEALPRIIPEKVTPVRLQPVSQREISLPTLAPEQEITFQHPPVLQPETQCPPQAV
SEQEILFRSQSVHYQEIPLHSPEIPEKESLLLSPTGPETEMETLLQSPVSQKETHFQTSA
ASQKETPLQTAEISRLAIWAAIQAVERKVEAQAMRLLTLEGRTGTAEKKLADCEKTAVEF
ANHLESKWVVLGTLLQEYGLLQRRLENMENLLKNRNFWILRLPPGSNGEVPKVPVTFDDV
AVHFSEQEWGNLSEWQKELYKNVMRGNYESLVSMDYAISKPDLMSQMERGERPTMQEQED
SEEGETPTDPSAAHDGIVIKIEVQTNDEGSESLETPEPLAGQVEEHGFQESELGEACGEQ
LDSDTQQETRLRESPEDTRDFSELKQMLVQQRNCTAEGIVIKTEEQDEEDEEEDEEDEDE
EEAQQLQALRPLSDRYDGGLFPAPLPVATPSEGSEGRPHLHLGGRTSVKRLAPPSLSEPR
ASAAAAANQQRNRRGERPFTCMECGKSFRLKINLIIHQRNHIKEGSYECTDCDISFRHKQ
QLTLHQRIHRVRGGYASPDRGTAYNPKHSLKPRPKSPGLGAGAGAGAKPYQCSECDSSFS
HKSSLTKHQITHTGERPYTCPECKKSFRLQISLVIHQRVHAGKHEVSFICSLCGKSFSRP
SHLLRHQRTHTGERPFKCPECEKSFSEKSKLTNHCRVHSRERPHACPECGKSFIRKHHLL
EHRRIHTGERPYHCTECGKRFTQKHHLLEHQRAHTGERPYPCTHCAKCFRYKQSLKYHLR
THTGE
Download sequence
Identical sequences F7GLZ3
XP_007504604.1.35504 ENSMODP00000002840 ENSMODP00000002840

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]