SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002952 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002952
Domain Number 1 Region: 130-182
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000102
Family Classic zinc finger, C2H2 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002952   Gene: ENSMODG00000002425   Transcript: ENSMODT00000003011
Sequence length 407
Comment pep:known_by_projection chromosome:BROADO5:1:703036865:703050018:1 gene:ENSMODG00000002425 transcript:ENSMODT00000003011 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSRRKQTNPNKVHWEQVFAGLEEQARQAMMKTDFPGDLGNQHPAIQQLRDQASSSSDSEG
DEEETTQDEVSSHTSEEDGGMVKVKKELENTEQSVGGNEVTEHLNSDPMLGLCQCPLCQL
DCGSREQLIAHVYQHTAAVVSAKSYVCPVCGRALSSPGSLGRHLLIHSEDQRSNCAVCGA
RFTSHATFNSEKLPEVLNMESIPPNHSEGPSNAEGKDIAFSPPVYPAGILLVCNNCAAYR
KLLEAQAPGVRKWALRRQNEPLEVRLQRLERERTAKKSRRDNETPEEREVRRMRDREAKR
LQRLQETDEQRARRLQRDREAMRLKRANETPEKRQARLIREREAKRLKRRLEKMDMMLRA
QFGQDPSAVAALAAEMSFFQLPVGGVELESQLLGKVAFEEQNSSSLH
Download sequence
Identical sequences F7E0F3
ENSMODP00000002952 ENSMODP00000002952 13616.ENSMODP00000002952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]