SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMODP00000002970 from Monodelphis domestica 76_5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMODP00000002970
Domain Number 1 Region: 604-1020
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 3.14e-101
Family Formin homology 2 domain (FH2 domain) 0.00000000205
Further Details:      
 
Domain Number 2 Region: 105-470
Classification Level Classification E-value
Superfamily ARM repeat 2.09e-100
Family Diap1 N-terninal region-like 0.0000000108
Further Details:      
 
Weak hits

Sequence:  ENSMODP00000002970
Domain Number - Region: 547-621
Classification Level Classification E-value
Superfamily beta-sandwich domain of Sec23/24 0.00141
Family beta-sandwich domain of Sec23/24 0.046
Further Details:      
 
Domain Number - Region: 525-556
Classification Level Classification E-value
Superfamily N-terminal domain of adenylylcyclase associated protein, CAP 0.00432
Family N-terminal domain of adenylylcyclase associated protein, CAP 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMODP00000002970   Gene: ENSMODG00000002444   Transcript: ENSMODT00000003031
Sequence length 1100
Comment pep:known_by_projection chromosome:BROADO5:X:74663391:75599492:-1 gene:ENSMODG00000002444 transcript:ENSMODT00000003031 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQPGTAAGPGGDEPGGGRSSKRSAGGRAAGDEETKNKPKLNIQIKTLADDVRDRITSFR
KSAVKKEKPLIQHPIDSQVAMTEFPAAQPLYEERSLNLTEKEVLDLFEKMMEDMNLNEER
KAPLRDKDFGTKHEMVVQYISATAKSGGLKNSKHECTLSSQEYVHELRSGISEEKLLNCL
ESLRVSLTSNPVSWVNNFGHEGLGLLLDLLEKLLDKKQQEIIDKKNQHKLIQCLRAFMNN
KFGLQRILGDERSLLLLARAIDPKQPSMMTEIVKILSAICIVGEDNILDKLLGAITTAAE
RNSKERFSPIVEGLENHEALQLQVACMQFINALVTSPYELDFRIHLRNEFLRSGLKKMLP
GLKEKDNDELDIQLRVFDENKDEDLNELSHRLNDIRAEMEYPSDKAQKLFFYHLLYNMLK
DTSSENYLLSILQHFLLIRNDYYVRPQYYKIIEECVSQIVLHGSGMDPDFKYRQRLDVDF
THLIDACVDKAKVEESEQKAAEFSKKFDEEFTARQEAQAELQRREEKIQELETELQQLRT
QVRVLSPPPPPPPPPPPLVPGGAVPPPPPPPPPPPPLPGGIPPPPPPPLPGGAVPPPPPL
FGGPPPPPPLGGIPPPPGVAVSLPFGMKQKKLYKPEVSMKRINWSKIEPQEISENCFWLK
VKEDKFENPDLFAKLALTFATQMKVKKNIDVSEEKKVAPKKKVKELRILDGKTAQNLSIF
LGSYRMSYEDIKNIILEVNEDMLSESLIHNLVKNLPEQKELSTLAQLKNEYDDLCEPEQF
GVVMSSVKMLRPRLHSILFKLTFEEHVNNIKPGIMAVTLACEETKKSESFNRLLELVLLV
GNYMNSGSRNAQSLGFNINFLCKIRDTKSSDQKTTLLHFLAEICEEKYRDILKFPDELAH
VESASKVSAQTLKSNLDAMEQQIARLESDITKFPKTEDEHDKFVEKIYSFAKSARDQYEK
LLTMHNNMTKLYDNLGEYFIFDTKIVAIDEFFGDLSSFRTLFLEAVKENNKRREMEEKSK
RAKLAKEKAELEKLERQKKKKQLMEMNKEGETGVMDNLLEALQSGAAFRDRRKRIPRNPD
NRRAPLERSRSRHNGAIPSA
Download sequence
Identical sequences F7DZA3
ENSMODP00000002970 ENSMODP00000002970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]